KEGG   Canis familiaris (dog): 609018Help
Entry
609018            CDS       T01007                                 

Gene name
LYPLA1
Definition
lysophospholipase I
Orthology
K06128  
lysophospholipase I [EC:3.1.1.5]
Organism
cfa  Canis familiaris (dog)
Pathway
Glycerophospholipid metabolism
Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    609018 (LYPLA1)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    609018 (LYPLA1)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     609018 (LYPLA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
29
AA seq 181 aa AA seqDB search
MGRSLCGPVMPITLNMNMAMPSWFDIFGLSPDSQEDEPGIKQAAENVKALIEQEVKNGIP
SNRIVLGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRTSFPQGPISGVNRDISILQC
HGDCDFLVPLTFASLTAEKLKTLVNPANVTFKTYEGMMHGSCQQEMMDIKHFIDRLLPPV
D
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgggcagaagcctttgtggaccagttatgcctataacattgaatatgaacatggctatg
ccttcttggtttgatatttttgggctttcaccagattcacaggaggatgaacctggaatt
aaacaggcagcagaaaatgtaaaagctttgatagagcaagaggtgaagaatggcatccct
tctaacagaattgttttgggaggattttctcagggaggagctttatctttatacactgct
cttaccacacagcagaaactggctggtgtcactgcactaagttgctggcttccactacgg
acttcatttccacagggtcctatcagtggtgttaacagagatatttctattcttcagtgc
catggagattgcgattttttagttcccctaacatttgcttctcttactgccgaaaagcta
aaaacattagtaaatccagccaatgtaaccttcaaaacctatgaaggcatgatgcacggt
tcatgtcaacaggaaatgatggatatcaagcatttcattgatagacttttacctccagtt
gattga

DBGET integrated database retrieval system