KEGG   Canis familiaris (dog): 609038Help
Entry
609038            CDS       T01007                                 

Gene name
LYZF2
Definition
lysozyme C, milk isozyme-like
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
cfa  Canis familiaris (dog)
Pathway
Salivary secretion
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Organismal Systems
  Digestive system
   04970 Salivary secretion
    609038 (LYZF2)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     609038 (LYZF2)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   609038 (LYZF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Structure
PDB: 

Jmol
Position
27
AA seq 148 aa AA seqDB search
MRSILVITILSYFFVADEAKIFSKCELARKLKSMGMDGFHGYSLANWVCMAEYESNFNTQ
AFNGRNSNGSSDYGIFQLNSKWWCKSNSHSSANACNIMCSKFLDDNIDDDIACAKRVVKD
PNGMSAWVAWVKHCKGKDLSKYLASCNL
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaggtctattctggtcatcaccatcctcagctacttctttgtagcagatgaggccaaa
atcttctccaagtgtgagctggcccgcaagctgaagagcatgggaatggatggcttccat
ggctacagcctggcaaactgggtctgcatggctgagtatgagagtaacttcaacacccag
gcctttaatgggagaaattccaatggcagtagtgactatggaatcttccagctgaacagc
aagtggtggtgcaaaagcaactctcactcctcggcaaatgcctgcaacataatgtgcagc
aagttcctggatgacaacatcgatgatgatatcgcctgtgccaagagggttgtgaaagat
cctaatgggatgtctgcctgggtggcctgggttaaacactgcaaaggcaaagatttgtcc
aaatacctggccagctgtaacctgtga

DBGET integrated database retrieval system