KEGG   Canis familiaris (dog): 609048Help
Entry
609048            CDS       T01007                                 

Definition
(RefSeq) dihydrofolate reductase
  KO
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cfa  Canis familiaris (dog)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Antifolate resistance
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    609048
   00670 One carbon pool by folate
    609048
 Human Diseases
  Drug resistance
   01523 Antifolate resistance
    609048
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     609048
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
19
AA seq 135 aa AA seqDB search
MGRKTWFSIPEKNRPLKDRINIVLSRDLKEPPQGAHFLAKSLDDALKLTEQPELANKVDM
VWIVGGSSVYKEAMNKPGHLRLFVTRIMHEFEGDTFFPEIDLEKYKLLPEYPGVLSDVQE
EKGIKYKFEVYEKND
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgggtaggaagacatggttctctattcctgagaagaatcgacctttaaaggacagaatt
aatatagttctcagcagagacctcaaggaacctccacaaggagctcattttcttgccaaa
agtctggatgatgctttaaaacttactgagcaaccagaattagcaaataaagtggacatg
gtttggatagtgggaggcagttctgtttataaggaagccatgaacaaaccaggccatctt
agactatttgtgacaaggattatgcatgaatttgaaggtgacacatttttcccagaaatt
gatttggagaaatataaacttctgccagaatacccaggtgttctttctgatgtccaggag
gagaaaggcattaagtacaaatttgaagtatatgagaagaacgattaa

DBGET integrated database retrieval system