KEGG   Canis familiaris (dog): 609310Help
Entry
609310            CDS       T01007                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 17-like protein 6
  KO
K11845  
ubiquitin carboxyl-terminal hydrolase 17 [EC:3.4.19.12]
Organism
cfa  Canis familiaris (dog)
Brite
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     609310
Peptidases [BR:cfa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   609310
Ubiquitin system [BR:cfa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    609310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
16
AA seq 545 aa AA seqDB search
MYLVDTVSADMEAAHLHPSEEPQFSASPKPQSCWSRRGGAEVHGGPSVPETTSPASKTLS
SPTDLLAPASAGLPPTKTPLSWKSLSQVGAGLQNMGNTCYVNATLQCLTYTEPLASYMLS
QQHGTTCRRQTSCMLCTLQAHLTRVLCHPGRVLRPLPLLLAAFHRHKQEDAHEYLMFILD
AMQQACLPEDKLSDPERPQDSTLIQQLFGGYWRSQIQCLHCQGISSTLEPYLDISLDIGD
AHSVSQALEQLVKPELLEGENAYHCSKCLEKVPASKVLTLHTSPKVLILVLRRFSNLTGN
KMTKEVQYPERLDLQHYLSEQRAGPLVYVLYAVLVHAGRSCHSGHYFCFIKAGNGQWYKM
DDAKVSSCDVICALRQPAYVLFYMQKTDLERDLGRESVEEGGLASPEADPTVVGEASGEP
ATDPSVNHPELEERGEETSRQQMTLDQWRCLQECNRPKPELNVRRREIALLANAVILHHS
KYRPEMPKNHPQQTVDLLTSAAGMLPPQVAGDVAKVPRVPGRARPTKRMSKKGQMSGEAV
QGCVS
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgtatcttgtggacactgtttctgcagacatggaggctgcccacctccacccctcagag
gagcctcagttcagcgcctctcccaaaccccagtcatgctggtcaaggagaggcggtgct
gaagtccacggaggaccctctgtgcccgagacgacatcccctgcatcaaagactctctcc
tccccgactgacctgttggctcccgcatcagcagggctgcctcccaccaagacgcctctg
agttggaagagcctttcccaggtgggagccgggcttcagaacatgggcaacacttgctat
gtgaatgcgaccctacagtgtctgacctacacagagcccctcgccagctacatgctgtct
cagcagcacgggaccacctgtaggaggcagacatcctgcatgctgtgtaccctgcaggct
cacctgacgcgggttctctgccatcctggacgtgtgctccggcccctgccactcctgctc
gccgccttccacagacacaagcaggaagatgcccatgagtatctcatgttcattctggat
gcaatgcagcaagcgtgcttgcctgaggacaagctctcagaccctgagcgtcctcaggac
agcaccctcatccagcaactctttggggggtactggaggtctcaaatccagtgtctccac
tgccaaggcatttcgagcactctggaaccttacctggacatcagcctggacatcggggat
gctcacagcgtcagccaagctttggagcagttggtgaagcccgaactgctggaaggtgaa
aatgcctaccattgtagtaagtgtctggagaaggtgcctgcatccaaggtgttgactttg
cacacttccccgaaggtcctcatcctggtcttgagacgattctcaaacttgacaggcaac
aaaatgactaaggaggtgcaatatcctgagcgccttgacttgcaacactacctgtctgag
cagagggcaggacccttggtttatgtgctctatgccgtgctggtgcacgctgggaggagt
tgccacagcggacattacttctgtttcataaaggcaggaaatggccagtggtataaaatg
gatgatgctaaggtcagctcctgtgatgtgatttgtgcgctgcgccaacctgcctatgtc
ctcttttatatgcagaagactgatctggagagagaccttgggagggagtcagtcgaggag
ggaggactcgcatctcccgaggcagaccccacggtggtgggtgaggcctcaggagagccg
gcaacggatccctccgtgaaccatcctgagttggaggagcgtggggaagagacctccaga
caacaaatgacattagaccagtggagatgcctccaagaatgcaaccgccctaagcctgaa
ctcaatgtcaggagaagagaaattgctcttcttgcgaacgcagtcatccttcaccactcc
aaatacagacctgagatgccgaagaatcatcctcagcagaccgtcgacctgctcacctct
gcagctgggatgctcccacctcaggtggccggggacgtggccaaagtcccgcgtgtgcca
gggagagcccgacctaccaagaggatgagcaagaagggacagatgtctggggaagcagtc
cagggatgtgtctcctaa

DBGET integrated database retrieval system