KEGG   Canis familiaris (dog): 609393Help
Entry
609393            CDS       T01007                                 

Gene name
GCH1
Definition
GTP cyclohydrolase 1
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cfa  Canis familiaris (dog)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    609393 (GCH1)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     609393 (GCH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
8
AA seq 249 aa AA seqDB search
MEKGPVRAPAKPRGARCSNGFPEGEPPRPGPSGPADKPPRPEAKSAQPADGWKGERPRSE
EDNELNLPNLAAAYSSILRSLGEDPQRQGLLKTPWRAATAMQFFTKGYQETISDVLNDAI
FDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQV
QERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTR
EEFLTLIKS
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaggtccggtgcgggcgccggcgaagccgcggggcgccaggtgcagtaatggg
ttccccgagggggagccgccgcgacccgggccgagcgggccggcagacaagccgccgcgg
ccggaggccaagagcgcgcagccggcggacggctggaagggcgagcggccccgcagcgag
gaggataacgagctgaacctccccaacctggcggccgcctactcgtcgatcctgcgctcg
ctgggcgaggacccccagcggcagggactgctcaagacgccctggagggcggctacggcc
atgcagttcttcaccaagggctaccaggagaccatctcagatgtcttaaatgatgctata
tttgatgaagatcatgatgagatggtgattgtgaaggacatagatatgttttccatgtgt
gaacatcatctagttccatttgttggaaaggtccatattggttatcttcctaacaagcaa
gtccttggcctcagcaaacttgcaaggattgtagaaatctatagtagacgattacaagtt
caagagcgccttacgaaacagattgccgtagcaatcacagaagccttgcggcctgctgga
gtcggggtggtggttgaagcaacacacatgtgtatggtaatgcgaggggtacagaaaatg
aacagcaaaactgtgaccagcacgatgttgggtgtgttccgggaagatccaaagactcgg
gaagagtttctaactctgattaagagctga

DBGET integrated database retrieval system