KEGG   Canis familiaris (dog): 609393Help
Entry
609393            CDS       T01007                                 

Gene name
GCH1
Definition
(RefSeq) GTP cyclohydrolase 1
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00790  Folate biosynthesis
cfa01100  Metabolic pathways
Module
cfa_M00842  Tetrahydrobiopterin biosynthesis, GTP => BH4
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    609393 (GCH1)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     609393 (GCH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_cyclohydroI QueF MAPKK1_Int
Motif
Other DBs
NCBI-GeneID: 609393
NCBI-ProteinID: XP_005623474
Ensembl: ENSCAFG00000014965
UniProt: E2RI70
Position
8
AA seq 249 aa AA seqDB search
MEKGPVRAPAKPRGARCSNGFPEGEPPRPGPSGPADKPPRPEAKSAQPADGWKGERPRSE
EDNELNLPNLAAAYSSILRSLGEDPQRQGLLKTPWRAATAMQFFTKGYQETISDVLNDAI
FDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQV
QERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTR
EEFLTLIKS
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaggtccggtgcgggcgccggcgaagccgcggggcgccaggtgcagtaatggg
ttccccgagggggagccgccgcgacccgggccgagcgggccggcagacaagccgccgcgg
ccggaggccaagagcgcgcagccggcggacggctggaagggcgagcggccccgcagcgag
gaggataacgagctgaacctccccaacctggcggccgcctactcgtcgatcctgcgctcg
ctgggcgaggacccccagcggcagggactgctcaagacgccctggagggcggctacggcc
atgcagttcttcaccaagggctaccaggagaccatctcagatgtcttaaatgatgctata
tttgatgaagatcatgatgagatggtgattgtgaaggacatagatatgttttccatgtgt
gaacatcatctagttccatttgttggaaaggtccatattggttatcttcctaacaagcaa
gtccttggcctcagcaaacttgcaaggattgtagaaatctatagtagacgattacaagtt
caagagcgccttacgaaacagattgccgtagcaatcacagaagccttgcggcctgctgga
gtcggggtggtggttgaagcaacacacatgtgtatggtaatgcgaggggtacagaaaatg
aacagcaaaactgtgaccagcacgatgttgggtgtgttccgggaagatccaaagactcgg
gaagagtttctaactctgattaagagctga

DBGET integrated database retrieval system