KEGG   Canis familiaris (dog): 609393Help
Entry
609393            CDS       T01007                                 

Gene name
GCH1
Definition
GTP cyclohydrolase 1
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cfa  Canis familiaris (dog)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cfa00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 249 aa AA seqDB search
MEKGPVRAPAKPRGARCSNGFPEGEPPRPGPSGPADKPPRPEAKSAQPADGWKGERPRSE
EDNELNLPNLAAAYSSILRSLGEDPQRQGLLKTPWRAATAMQFFTKGYQETISDVLNDAI
FDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQV
QERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTR
EEFLTLIKS
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaggtccggtgcgggcgccggcgaagccgcggggcgccaggtgcagtaatggg
ttccccgagggggagccgccgcgacccgggccgagcgggccggcagacaagccgccgcgg
ccggaggccaagagcgcgcagccggcggacggctggaagggcgagcggccccgcagcgag
gaggataacgagctgaacctccccaacctggcggccgcctactcgtcgatcctgcgctcg
ctgggcgaggacccccagcggcagggactgctcaagacgccctggagggcggctacggcc
atgcagttcttcaccaagggctaccaggagaccatctcagatgtcttaaatgatgctata
tttgatgaagatcatgatgagatggtgattgtgaaggacatagatatgttttccatgtgt
gaacatcatctagttccatttgttggaaaggtccatattggttatcttcctaacaagcaa
gtccttggcctcagcaaacttgcaaggattgtagaaatctatagtagacgattacaagtt
caagagcgccttacgaaacagattgccgtagcaatcacagaagccttgcggcctgctgga
gtcggggtggtggttgaagcaacacacatgtgtatggtaatgcgaggggtacagaaaatg
aacagcaaaactgtgaccagcacgatgttgggtgtgttccgggaagatccaaagactcgg
gaagagtttctaactctgattaagagctga

DBGET integrated database retrieval system