KEGG   Canis familiaris (dog): 609437Help
Entry
609437            CDS       T01007                                 

Definition
ubiquitin carboxyl-terminal hydrolase 17-like protein 17-like
Orthology
K11845  
ubiquitin carboxyl-terminal hydrolase 17 [EC:3.1.2.15]
Organism
cfa  Canis familiaris (dog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 535 aa AA seqDB search
MEAAHLHPSEEPQFSASPKPQSCWSRRGGAEVHGGPSVPETTSPASKTLSSPTDPLAPAT
AGLPPTKTPLSWKSLSQVGAGLQNMGNTCYVNATLQCLTYTEPLASYMLSQQHGTTCRRQ
TSCMLCTLQAHLTRVLCHPGRVLRPLPLLLAAFHRHKQEDAHEYLMFILDAMQQACLPED
KLSDPECPQDSTLIQQLFGGYWRSQIQCLHCQGISSTLEPYLDISLDIGAAHSVSQALEQ
LVKPELLEGENAYHCSKCLEKVPASKVLTLHTSPKVLILVLRRFSDLTGNKMTKEVRYPE
RLDMQHCLSEQRAGLLVYVLYAVLVHAGRSCHSGHYFCFVKAGNGQWYKMDDAKVSACDV
TCALHQPAYILFYMQKTDLERDLGRESVKEGGLASPEADHTVVGEASGELATDPSVNLPE
LEERGEETSRQQMTLDQWRCLQECNRPQPELNVRGREIALPANAVILHHSKYRPEMPKNH
PQQTVDLLTSAAGMIPPQVAGDVAKLPHVPGRARPTKRTSKKGQRSGEAVQGCVS
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggaggctgcccacctccacccctcagaggagcctcagttcagcgcctctcccaaaccc
cagtcatgctggtcaaggagaggcggtgctgaagtccacggaggaccctctgtgcccgag
acgacatcccctgcatcaaagactctctcctccccgactgacccgttggctcccgcaaca
gcagggctgcctcccaccaagacgcctctgagttggaagagcctttcccaggtgggagcc
gggcttcagaacatgggcaacacttgctatgtgaatgcgaccctacagtgtctgacctac
acagagcccctcgccagctacatgctgtcccagcagcacgggaccacctgtaggaggcag
acatcctgcatgctgtgtaccctgcaggctcacctgacgcgggttctctgccatcctgga
cgtgtgctccggcccctgccactcctgctcgccgccttccacagacacaagcaggaagat
gcccatgagtatctcatgttcattctggatgcaatgcagcaagcgtgcttgcctgaggac
aagctctcagaccctgagtgtcctcaggacagcaccctcatccagcaactctttgggggg
tactggaggtctcaaatccagtgtctccactgccaaggcatttcgagcactctggaacct
tacctggacatcagcctggacatcggggctgctcacagcgtcagccaagctttggagcag
ttggtgaagcccgaactgctggaaggtgaaaatgcctaccattgtagtaagtgtctggag
aaggtgcctgcgtccaaggtgttgactttgcacacttccccgaaggtcctcatcctggtc
ttgagacgattctcagacttgacaggcaacaaaatgactaaggaggtgcgatatcctgag
cgccttgacatgcaacactgcctgtctgagcagagggcaggactcttggtttatgtgctc
tatgccgtgctggtgcatgctgggaggagttgccacagcggacattacttctgtttcgta
aaggcaggaaatggccagtggtataaaatggatgatgctaaggtcagcgcctgtgatgtg
acttgtgcgctgcaccaacctgcctatatcctcttttatatgcagaagactgatctggag
agagaccttgggagggagtcagtcaaggagggaggactcgcatctcccgaggcagaccac
acagtggtgggtgaggcctcaggagagctggcaacggatccctccgtgaatcttcctgag
ttggaggagcgtggggaagagacctcaaggcaacaaatgacattagaccagtggagatgc
ctccaagaatgcaaccgccctcagcctgaactcaatgtcaggggaagagaaattgctctt
cctgcgaacgcagtcatccttcaccactccaaatacagacctgagatgccgaagaatcat
cctcagcagaccgtcgacctgctcacctctgcagctgggatgatcccacctcaggtggcc
ggggacgtggccaaactcccgcatgtgccaggaagagcccgacctaccaagaggacgagc
aagaagggacagaggtctggggaagcagtccagggatgtgtctcctaa

DBGET integrated database retrieval system