KEGG   Canis familiaris (dog): 609510Help
Entry
609510            CDS       T01007                                 

Gene name
GPT2
Definition
glutamic pyruvate transaminase (alanine aminotransferase) 2
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
cfa  Canis familiaris (dog)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    609510 (GPT2)
   01210 2-Oxocarboxylic acid metabolism
    609510 (GPT2)
   01230 Biosynthesis of amino acids
    609510 (GPT2)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    609510 (GPT2)
Enzymes [BR:cfa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     609510 (GPT2)
Amino acid related enzymes [BR:cfa01007]
 Aminotransferase (transaminase)
  Class I
   609510 (GPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
15
AA seq 315 aa AA seqDB search
MGQQPITFLRQVMALCTYPNLLDSPSFPEDAKKRARRILQACGGNSLGSYSASQGVNCIR
EDVAAYVTRRDGGVPADPFNIYLTTGASDGISTILKILVSGGGKSRTGVLIPIPQYPLYS
AVISELDAIQVNYYLDEENCWALDVNELRRAVQEAKDHCNPKVLCIINPGNPTGQVQSRK
CIEDVIHFAWEEKLFLLADEVYQDNVYSPDCRFHSFKKVLYEMGPEYSSNVELASFHSTS
KGYMGEYVGLGFLPRPHHSALPAGGLLRGEHGAHLRGPVHELSPGAGTPVRRGPAGAPGS
PRFLPGPRCCPGTEP
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgggccagcagcctataaccttcctccgacaggtgatggcactgtgcacctaccccaac
ctgctggacagccccagcttcccagaagatgctaagaaacgagcccggaggatcctacag
gcttgtggcgggaacagcctggggtcctacagtgccagccagggcgtcaactgcatccgc
gaggacgtggccgcctacgtcaccaggagggacggcggggtgcccgcggaccccttcaac
atttacctgaccactggagccagcgacggcatttctacgatcctgaagatcctggtgtcc
gggggtggcaagtcgcggacgggcgtgctgatccccatcccacagtaccccctctactcg
gccgtcatctccgagctcgacgccatccaggtgaactactacttggacgaggagaactgc
tgggccctcgacgtgaacgagctccggcgggccgtgcaggaggctaaggaccactgtaac
cccaaggtgctgtgcatcatcaaccccgggaaccccacaggtcaggtgcaaagcaggaag
tgcatagaggacgtcatccactttgcctgggaagagaagctctttctcctggcagatgag
gtgtaccaggacaacgtgtactctccggactgcagattccactccttcaagaaggtgctc
tacgagatggggcccgagtactcgagcaacgtggagcttgcgtccttccactctacctcc
aagggctacatgggcgagtacgttggccttggcttcctcccgcggccccaccactcggcc
ctgcccgctggcggcctgctgcgcggggaacacggggcccatctcagggggcctgtgcat
gagctcagccctggtgcagggacgcccgtgcggcgaggtcctgctggggccccgggctcc
ccgcgcttcctgccgggcccacgctgctgccctgggactgaaccctga

DBGET integrated database retrieval system