KEGG   Canis familiaris (dog): 609559Help
Entry
609559            CDS       T01007                                 

Gene name
MAP2K5
Definition
(RefSeq) mitogen-activated protein kinase kinase 5
  KO
K04463  
mitogen-activated protein kinase kinase 5 [EC:2.7.12.2]
Organism
cfa  Canis familiaris (dog)
Pathway
MAPK signaling pathway
Gap junction
Neurotrophin signaling pathway
Oxytocin signaling pathway
Module
MAPK (ERK5) signaling
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    609559 (MAP2K5)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    609559 (MAP2K5)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    609559 (MAP2K5)
  Nervous system
   04722 Neurotrophin signaling pathway
    609559 (MAP2K5)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     609559 (MAP2K5)
Protein kinases [BR:cfa01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   609559 (MAP2K5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
30
AA seq 438 aa AA seqDB search
MLWLALGPFHAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAF
EYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGL
KVNTRAGPSQHGSPAVSDSLPSNSLKKSSAELKKILANGQMNEQDIRYRDTLGHGNGGTV
YKAYHVPSGKILAVKVILLDITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISIC
TEFMDGGSLDVYRKIPEHVLGRIAIAVVKGLTYLWSLKILHRDVKPSNMLVNTRGQVKLC
DFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMEIQKNQGSLMPLQ
LLQCIVDEDSPVLPVGEFSEPFVHFITQCMRKQPKERPAPEDLMGHPFIMQFNDGNAAVV
SMWVCRALEERRSQQGPP
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgctgtggctcgcccttggccccttccatgccatggagaaccaggtgctggtgattcgt
atcaagattccaaatagtggcgcggtggactggacagtgcactccgggccgcagttactc
ttcagggacgtgctggatgtgataggccaggttctgcctgaagcaacaaccacagcattt
gaatatgaagatgaagatggtgaccgaattacagtgaggagtgatgaagaaatgaaggcc
atgctgtcttattattattccacagtaatggaacagcaagtaaatggacagttaatagag
cctctgcagatatttccaagagcctgcaagcctcctggggaacggaacatacatggcctg
aaggtgaatacccgagctggaccctctcaacacggcagcccagcagtctctgattcactt
ccaagcaatagcttaaagaagtcttctgcagaactgaaaaaaatattagccaatggtcag
atgaatgaacaagacatacggtatcgagacactcttggccatggcaacggaggcacagtc
tacaaagcatatcatgtcccgagtgggaaaatattagctgtaaaggtcatactactagat
attacactggaacttcagaagcaaattatgtctgaattggaaattctttataagtgtgat
tcatcatatatcatagggttttatggtgcatttttcgtagaaaacaggatttcaatatgt
acagaattcatggatgggggatccttggatgtatatagaaaaattccagagcatgtcctt
ggaagaattgcaatagcagttgttaaaggccttacctacttgtggagtttaaagatttta
catagagatgtgaagccctccaatatgctagtaaacacaagaggacaggtcaagctgtgc
gattttggagttagcactcagctggtgaattctatagccaagacgtatgttggaacaaat
gcttatatggcgcctgaaagaatttcaggggagcagtatggaatccattctgatgtctgg
agtttaggaatctctttcatggagattcagaaaaaccagggatctttaatgcctctccag
cttctgcagtgcattgttgatgaggattcgcccgtccttccggttggagagttctccgag
ccatttgtacatttcatcactcagtgcatgcgaaaacaaccaaaagaaagaccagcacct
gaggacctgatgggccacccattcatcatgcagttcaatgacggaaacgccgccgtggtg
tccatgtgggtgtgcagggcgctggaggagaggcggagccagcaggggcccccgtga

DBGET integrated database retrieval system