KEGG   Canis familiaris (dog): 609559Help
Entry
609559            CDS       T01007                                 

Gene name
MAP2K5
Definition
(RefSeq) mitogen-activated protein kinase kinase 5
  KO
K04463  mitogen-activated protein kinase kinase 5 [EC:2.7.12.2]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04010  MAPK signaling pathway
cfa04540  Gap junction
cfa04722  Neurotrophin signaling pathway
cfa04921  Oxytocin signaling pathway
cfa05418  Fluid shear stress and atherosclerosis
Module
cfa_M00690  MAPK (ERK5) signaling
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    609559 (MAP2K5)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    609559 (MAP2K5)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    609559 (MAP2K5)
  Nervous system
   04722 Neurotrophin signaling pathway
    609559 (MAP2K5)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    609559 (MAP2K5)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     609559 (MAP2K5)
Protein kinases [BR:cfa01001]
 Serine/threonine kinases: STE group
  STE7 family
   609559 (MAP2K5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PB1 Kinase-like Haspin_kinase Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 609559
NCBI-ProteinID: XP_003640108
Ensembl: ENSCAFG00000017454
Position
30
AA seq 438 aa AA seqDB search
MLWLALGPFHAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAF
EYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGL
KVNTRAGPSQHGSPAVSDSLPSNSLKKSSAELKKILANGQMNEQDIRYRDTLGHGNGGTV
YKAYHVPSGKILAVKVILLDITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISIC
TEFMDGGSLDVYRKIPEHVLGRIAIAVVKGLTYLWSLKILHRDVKPSNMLVNTRGQVKLC
DFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMEIQKNQGSLMPLQ
LLQCIVDEDSPVLPVGEFSEPFVHFITQCMRKQPKERPAPEDLMGHPFIMQFNDGNAAVV
SMWVCRALEERRSQQGPP
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgctgtggctcgcccttggccccttccatgccatggagaaccaggtgctggtgattcgt
atcaagattccaaatagtggcgcggtggactggacagtgcactccgggccgcagttactc
ttcagggacgtgctggatgtgataggccaggttctgcctgaagcaacaaccacagcattt
gaatatgaagatgaagatggtgaccgaattacagtgaggagtgatgaagaaatgaaggcc
atgctgtcttattattattccacagtaatggaacagcaagtaaatggacagttaatagag
cctctgcagatatttccaagagcctgcaagcctcctggggaacggaacatacatggcctg
aaggtgaatacccgagctggaccctctcaacacggcagcccagcagtctctgattcactt
ccaagcaatagcttaaagaagtcttctgcagaactgaaaaaaatattagccaatggtcag
atgaatgaacaagacatacggtatcgagacactcttggccatggcaacggaggcacagtc
tacaaagcatatcatgtcccgagtgggaaaatattagctgtaaaggtcatactactagat
attacactggaacttcagaagcaaattatgtctgaattggaaattctttataagtgtgat
tcatcatatatcatagggttttatggtgcatttttcgtagaaaacaggatttcaatatgt
acagaattcatggatgggggatccttggatgtatatagaaaaattccagagcatgtcctt
ggaagaattgcaatagcagttgttaaaggccttacctacttgtggagtttaaagatttta
catagagatgtgaagccctccaatatgctagtaaacacaagaggacaggtcaagctgtgc
gattttggagttagcactcagctggtgaattctatagccaagacgtatgttggaacaaat
gcttatatggcgcctgaaagaatttcaggggagcagtatggaatccattctgatgtctgg
agtttaggaatctctttcatggagattcagaaaaaccagggatctttaatgcctctccag
cttctgcagtgcattgttgatgaggattcgcccgtccttccggttggagagttctccgag
ccatttgtacatttcatcactcagtgcatgcgaaaacaaccaaaagaaagaccagcacct
gaggacctgatgggccacccattcatcatgcagttcaatgacggaaacgccgccgtggtg
tccatgtgggtgtgcagggcgctggaggagaggcggagccagcaggggcccccgtga

DBGET integrated database retrieval system