KEGG   Canis familiaris (dog): 609588Help
Entry
609588            CDS       T01007                                 

Gene name
USP22
Definition
ubiquitin specific peptidase 22
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
cfa  Canis familiaris (dog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 482 aa AA seqDB search
SENVRFLILFTPFQAKSCVCHVCGVHLNRLHSCLHCVFFGCFTKKHIHEHAKSKRHNLAI
ELMYGGIYCFLCQDYIYDKDIEIIAKEEQRKAWKMQGVGEKFSTWEPTKRELELLKHNPK
RRKITSNCTIGLRGLINLGNTCFMNCIVQALTHTPLLRDFFLSDRHRCEMQSPSSCLVCE
MSSLFQEFYSGHRSPHIPYKLLHLVWTHARHLAGYEQQDAHEFLIAALDVLHRHCKGDDN
GKKANNPNHCNCIIDQIFTGGLQSDVTCQVCHGVSTTIDPFWDISLDLPGSSTPFWPLSP
GSEGSVVNGESHVAGTTTLTDCLRRFTRPEHLGSSAKIKCSGCHSYQESTKQLTMKKLPI
VACFHLKRFEHSAKLRRKITTYVSFPLELDMTPFMASSKESRMNGQYQQPTDSLNNDNKY
SLFAVVNHQGTLESGHYTSFIRQHKDQWFKCDDAIITKASIEDVLDSEGYLLFYHKQFLE
YE
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
tctgagaacgtaaggtttttaattctcttcactccctttcaggccaagtcatgcgtctgt
cacgtttgtggtgttcacctgaacaggctccactcctgcctgcactgtgtcttctttggc
tgcttcacaaagaaacatattcatgaacatgcgaagtccaagcggcacaacctggccata
gaacttatgtatggaggcatctactgctttttgtgtcaggactacatatatgacaaagat
atagaaatcattgccaaagaggaacagcggaaagcttggaaaatgcaaggtgttggggag
aagttttcaacttgggagccaaccaaacgagagcttgaactgctgaaacacaacccgaaa
aggcgaaagatcacctccaactgcaccataggtctgcggggactgatcaaccttggaaac
acgtgcttcatgaactgcatcgtccaggctctcacccacacgccacttctgcgagatttc
ttcctctccgacaggcaccggtgtgagatgcagagccccagctcatgtctggtctgtgag
atgtcgtcactttttcaggagttttactcggggcaccgctccccccatatcccgtacaag
ttgctgcacctggtgtggactcacgcgcggcacctggcggggtacgagcagcaggatgcg
cacgagttcctcatcgcagccctggacgtcctgcaccgacactgcaaaggtgacgataat
gggaagaaggccaacaaccccaatcactgcaactgcatcatagatcaaatcttcacgggc
gggctgcagtcggacgtcacctgccaagtctgccatggagtctctaccaccatagacccc
ttctgggacatcagtttagatctgcctggctcttccaccccgttttggcccctgagccca
gggagtgaaggcagcgtggtgaatggggaaagccatgtagcaggaaccactacgcttacg
gactgcttgaggaggtttaccagaccagagcacttaggaagcagtgccaagatcaagtgt
agtggctgccatagctaccaggagtccaccaagcagctcaccatgaagaaactgcccatt
gtagcctgttttcatctcaaacgatttgaacactcggccaagctgaggcggaagatcacc
acatacgtgtcattccccctggaactggacatgacccccttcatggcatccagcaaagag
agcaggatgaatggacagtaccagcagccaacggatagtctcaacaatgacaataagtac
tccttgtttgccgtagttaaccaccaggggaccctggagagtggccactacaccagcttc
attcggcagcacaaggaccagtggttcaaatgtgacgatgccatcatcaccaaggccagc
attgaggacgtgctggacagtgagggatacctgctgttctaccacaaacagttcctggag
tatgagtag

DBGET integrated database retrieval system