KEGG   Canis familiaris (dog): 609616Help
Entry
609616            CDS       T01007                                 

Gene name
PRKG1
Definition
protein kinase, cGMP-dependent, type I
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
cfa  Canis familiaris (dog)
Pathway
cGMP-PKG signaling pathway
Gap junction
Platelet activation
Circadian entrainment
Long-term depression
Olfactory transduction
Salivary secretion
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    609616 (PRKG1)
 Cellular Processes
  Cell communication
   04540 Gap junction
    609616 (PRKG1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    609616 (PRKG1)
  Digestive system
   04970 Salivary secretion
    609616 (PRKG1)
  Nervous system
   04730 Long-term depression
    609616 (PRKG1)
  Sensory system
   04740 Olfactory transduction
    609616 (PRKG1)
  Environmental adaptation
   04713 Circadian entrainment
    609616 (PRKG1)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     609616 (PRKG1)
Protein kinases [BR:cfa01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   609616 (PRKG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
26
AA seq 671 aa AA seqDB search
MSELEEDFAQVLMLKEERIKELERRLSEKEEEIQELKRKLHKCQSVLPAPSPHIGPRTTR
AQGISAEPQTYRSFHDLRQAFRKFAKSERSKDLIKEAILDNDFMKNLELSQIQEIVDCMY
PVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTAT
VKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEET
HYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDV
RTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFANLKLSDF
NIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDF
IVRLYRTFKDSKYLYMLMEVCLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGI
IYRDLKPENLILDHRGYTKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISAD
YWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPS
ERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPP
PDDNSGWDIDF
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagctggaggaggacttcgcccaggtcctcatgctcaaggaggagaggatcaag
gagctggagaggcggctgtcggagaaggaggaggagatccaggagctcaagcggaagctg
cacaaatgccagtcggtgctgcccgcgccctcgccgcacatcgggccgcgcaccacgcgg
gcgcagggcatctcggccgagccgcagacctaccgctccttccacgacctccgacaggcg
ttccgcaagttcgccaagtccgagaggtccaaggatctcataaaggaagcaatccttgac
aatgacttcatgaagaacctggagctgtcgcagatccaggagattgtggattgtatgtac
ccggtggagtacggcaaagacagttgcatcatcaaagaaggagatgtggggtcactggtg
tacgtcatggaagatggtaaggttgaagtcacgaaagaaggtgtgaagctgtgtaccatg
gggccaggaaaagtgttcggggagttggcgattctttacaactgtacccggacggcgacc
gtcaagactcttgtaaatgtgaaactctgggccatcgatcgacaatgtttccaaaccatc
atgatgaggacgggactcatcaagcataccgagtatatggaatttttaaaaagtgtcccc
acgttccagagccttcctgaagagatcctgagtaagcttgctgatgtccttgaagagacc
cactatgagaatggggaatatatcatcaggcaaggtgcaagaggcgacaccttctttatc
atcagcaaaggaacggtgaatgtcactcgggaagactcacccagtgaagacccggtcttt
cttagaactttagggaaaggagactggtttggagagaaagccttgcagggggaggatgtg
aggacagcaaacgtaattgccgcagaagctgtgacctgccttgtcatcgacagagactct
ttcaagcatttgattggaggactggatgatgtttccaataaagcatatgaagatgcagaa
gctaaagcaaaatacgaagccgaagctgctttcttcgccaacctgaagctgtctgacttc
aacatcatcgacaccctcggcgtcggaggcttcggacgcgtggagctggtccagttgaaa
agtgaagaatccaaaacctttgctatgaagattctcaagaaacgccacatcgtagacaca
agacagcaggagcacatccgctccgagaagcagatcatgcagggggcgcattccgacttc
atagtgagattgtacaggacgtttaaggacagcaaatatttgtacatgttgatggaagtg
tgcctaggtggagagctctggaccattctcagggatcgaggttcatttgaagattctacg
accagattctacacagcatgcgtggtggaggcgttcgcctatctgcattccaaaggaatc
atttacagggacctcaagccagagaatctcatcctggatcacagaggctacaccaagctg
gttgattttggctttgcaaagaaaataggatttggaaagaaaacatggactttttgtggg
actccagaatacgtagctccagagatcatcctgaacaaaggccatgacatttcagccgac
tactggtcactgggaatcctaatgtatgaacttctgactggcagcccacctttctcaggc
ccagatcctatgaaaacctataacatcatactgagggggattgacatgatagaatttcca
aagaagattgccaaaaatgctgctaacttaattaaaaaactctgcagggataacccatca
gaaagattagggaatttgaaaaacggcgtgaaagacattcagaagcacaaatggtttgag
ggctttaattgggaaggcttaagaaaaggcaccttgacacctcctataataccaagtgtt
gcatcacccacagacacaagcaatttcgacagtttccctgaggacaatgatgaaccgcca
cctgatgacaactcaggatgggacatagacttctaa

DBGET integrated database retrieval system