KEGG   Canis familiaris (dog): 610195Help
Entry
610195            CDS       T01007                                 

Gene name
CYP2J2
Definition
(RefSeq) cytochrome P450, family 2, subfamily J, polypeptide 2
  KO
K07418  cytochrome P450 family 2 subfamily J [EC:1.14.14.1]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00590  Arachidonic acid metabolism
cfa00591  Linoleic acid metabolism
cfa01100  Metabolic pathways
cfa04726  Serotonergic synapse
cfa04750  Inflammatory mediator regulation of TRP channels
cfa04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    610195 (CYP2J2)
   00591 Linoleic acid metabolism
    610195 (CYP2J2)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    610195 (CYP2J2)
  Nervous system
   04726 Serotonergic synapse
    610195 (CYP2J2)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    610195 (CYP2J2)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     610195 (CYP2J2)
Cytochrome P450 [BR:cfa00199]
 Cytochrome P450, animal type
  CYP2 family
   610195 (CYP2J2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 Phage_int_SAM_1
Motif
Other DBs
NCBI-GeneID: 610195
NCBI-ProteinID: XP_852725
Ensembl: ENSCAFG00000018871
UniProt: F6Y7G5
Position
5
AA seq 502 aa AA seqDB search
MLAAVGSLAATLWAVLHLRTLLLGAVAFLFFADFLKRRRPKNYPPGPVPLPFVGNFFHLD
FEQSHLKLQRFVKKYGNVFSVQMGDMPLVVVTGLPLIKEVLVDQNQVFVNRPITPIRERV
FKNSGLIMSSGQIWKEQRRFTLATLKNFGLGRKSIEERIQEEAHHLIQAIEEENGQPFNP
HFKINNAVSNIICSITFGKRFEYQDEQFQELLRLLDEVTCLETSMRCQLYNVFPWIIKFL
PGPHQKLFNDWEKLKLFIAHMTENHRRDWNPAEPRDFIDAYLKEMEKNRGNATSSFHEEN
LIYSTLDLFFAGTETTSTTLRWGLLYLALNPEIQEKVQAEIDRVIGQSQLPGLAVRESMP
YTNAFIHEVQRMGNIVPLNVPREVTGDTTLAGYYLPKGTVIVTNLTALHRDPAEWATPDT
FNPEHFLENGQFKKREAFLPFSIGKRVCIGEQLARSELFIFFTSLVQRFTFRPPDNEKLS
LEFRTGLTISPVSHRLRAIPRS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcggcggtgggctccctggcggccaccctctgggcagtgcttcatctccgcacc
ctcctgctgggtgccgtcgcctttctgttctttgctgatttcctcaaaagacggcgccca
aagaactacccgccgggccccgttcccctgcccttcgtgggcaacttcttccatctggac
tttgagcagtcgcacctgaagctgcagcggtttgtaaagaaatatggaaacgtttttagt
gtgcagatgggtgacatgcctttagttgttgtaactggattgcccttgatcaaagaagtt
cttgtggaccagaaccaagtctttgtgaaccgccctatcacacctatccgtgaacgtgtc
tttaagaacagtggattgatcatgtctagtggccaaatatggaaggaacaaagaaggttc
accctggcaacactaaagaactttggtctaggaaggaagagcatagaggaacgcattcag
gaggaagcccatcatctcatccaggcgatagaggaggagaatggacagcctttcaaccct
cacttcaagatcaacaatgcagtttccaatatcatttgctctatcacctttggaaagcgc
tttgagtaccaggatgaacagtttcaggaattgctgaggttgctggatgaggtcacatgt
ctggagacatcaatgagatgccagctctacaatgtctttccatggattattaaatttctc
cctggaccccatcaaaaactctttaacgactgggagaaactgaaattgttcattgctcat
atgactgaaaaccacaggagagactggaatcctgctgaaccaagagattttattgacgct
tacctcaaggaaatggaaaagaataggggcaatgctacttcaagtttccatgaagaaaac
ctcatctacagcaccctagacctcttctttgctggaactgagacaacatctacaaccctg
cgctggggtctgctttacttggccctcaacccagaaatccaagaaaaagtccaagctgag
atcgacagggtgattggccagtcacaactgccaggtttagctgttcgagagtccatgccc
tacaccaatgccttcatccatgaggtgcagagaatgggaaacatcgttcccctgaatgtg
cccagggaagtgacaggtgacaccaccctggctggatactacctgcccaaggggaccgtg
atcgtgaccaacctgactgcactgcacagggaccctgcagaatgggccacccctgacacg
ttcaacccagagcattttctggagaatggacagtttaagaaaagggaagcctttctgcct
ttctcaataggaaagcgggtatgcattggagaacagttggccaggtctgagctgtttatt
ttcttcacttcccttgtgcaaagatttaccttcaggcccccagacaatgagaagctgagc
ctcgagttcagaacgggactcaccatctccccagtcagccaccgactccgtgcaatccct
cggtcctga

DBGET integrated database retrieval system