KEGG   Canis familiaris (dog): 610203Help
Entry
610203            CDS       T01007                                 

Gene name
RASGRF2
Definition
(RefSeq) Ras protein specific guanine nucleotide releasing factor 2
  KO
K12326  Ras-specific guanine nucleotide-releasing factor 2
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04010  MAPK signaling pathway
cfa04014  Ras signaling pathway
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    610203 (RASGRF2)
   04010 MAPK signaling pathway
    610203 (RASGRF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF RhoGEF RasGEF_N PH IQ DUF641
Motif
Other DBs
NCBI-GeneID: 610203
NCBI-ProteinID: XP_013967233
Ensembl: ENSCAFG00000008744
UniProt: J9PAM7
Position
3
AA seq 1250 aa AA seqDB search
MQKSVRYNEGHALHLAFLARKEGTKREKMSKRAAEASRWHEKWFALYQNVLFYFEGEQSG
RPAGMYLLEGCSCERTPAPPRAGVGPPGARDALDKQYYFTVLFGHEGQKPLELRCEEEQD
GKEWMEAIHQASYADILIEREVLMQKYIHLVQIVETEKIAANQLRHQLEDQDTEIERLKS
EIIALNKTKERMRPYQSNQEDEDPDIKKIKKVQSFMRGWLCRRKWKTIVQDYICSPHAES
MRKRNQIVFTMVEAESEYVHQLYILVNGFLRPLRMAASSKKPPISHDDVSSIFLNSETIM
FLHEIFHQGLKARIANWPTLILADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFD
KLLKQYEANPACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLE
ELSRIMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFIRQGSLIQVPSVERGKLSKV
RLGSLSLKKEGERQCFLFTKHFLICTRSSGGKLHLLKTGGVLSLIECTLIEEPDASDDDS
KGSGQVFGHLDFKIVVEPPDSAPFTVVLLAPSRQEKAAWTSDISQCVDNIRCNGLMTIVF
EENSKVTVPHMIKSDARLHKDDTDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSID
FLNTFLHTYRIFTTAAVVLAKLSDIYKRPFTSIPVRSLELFFATSQNNRGEHLVDGKSPR
LCRKFSSPPPLAVSRTSSPVRARKLSLTSPLNSRIGALDLTTCSASSSPTATHSPAASPP
PHTGKVPLDLSRGLPSPEQSPGSVEEHVDNPRMDLCNKLKRSIQRAVLESVPVDRAGVEG
SPAVDSTDLSPCRSPSTPQHLRYRQPVGQTADNSHCSVSPASAFAIATAAAGHGSPPGFN
NTERTCDKEFIIRRTATNRVLNVLRHWVSKHAQDFELNNELKMNVLNLLEEVLRDPDLLP
QERKATANILRALSQDDQDDIHLKLEDIIQLTDCPKAECFETLSAMELAEQITLLDHIIF
RSIPYEEFLGQGWMKLDKNERTPYIMKTSQHFNDMSNLVASQIMNYADVSSRANAIEKWV
AVADICRCLHNYNGVLEITSALNRSAIYRLKRTWAKVSKQTKALMDKLQKTVSSEGRFKN
LRETLKNCNPPAVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQT
CYRIDHQPKGELCFTRRNSKIQSSWYLSLLHLLVSLGGMKYIDADSEKKN
NT seq 3753 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagagcgtgcgctacaacgaggggcacgccctgcacctggccttcctggcccgc
aaggagggcaccaagcgcgaaaaaatgagcaagagggcggccgaggcgagccgctggcac
gagaagtggttcgccctctaccagaatgtgctcttctacttcgagggcgagcagagcggc
cgcccggcgggcatgtacctcctggagggctgcagctgcgagcgcacgcccgcgccgccc
cgggccggggtcgggccgcccggcgcccgggacgcgctggacaagcagtactactttacc
gttctttttggccatgaaggtcagaaacctctggagctgcgctgtgaggaggagcaggac
ggtaaagagtggatggaggccattcaccaagccagttatgcagacattttgattgagagg
gaagtgttaatgcagaagtacattcatctagttcagatcgtagagacagaaaaaattgca
gctaaccagctccggcatcaacttgaagatcaagatacagaaattgaaagacttaaatca
gagattatcgctcttaataaaaccaaggaacgaatgcggccttaccaaagcaatcaagaa
gatgaggatccagacatcaagaagattaaaaaggttcagagcttcatgagaggatggttg
tgtagaaggaaatggaagactattgtgcaggattacatttgttctcctcatgctgaaagt
atgaggaagagaaaccagattgtgttcaccatggttgaagccgagtcagagtatgttcac
cagctctacatcctggtcaacggcttcctccggcccctgcggatggcggccagctccaag
aagcctcccatcagccatgatgatgtcagcagcattttcctcaacagtgaaacgattatg
tttcttcatgaaatatttcaccaaggactgaaggcgaggatagcaaactggcctactttg
attttagctgatctgtttgatattttgctccccatgttgaacatttatcaagaatttgtg
cgtaatcaccagtacagcctccaagtgcttgccaattgtaagcaaaacagagattttgac
aaactcttaaaacagtatgaagccaaccctgcctgtgaggggaggatgctggaaacgttc
ctgacctatccaatgtttcagatccccaggtatatcatcacacttcatgaactcctagct
catacacctcatgagcatgtggaaaggaaaagtctggagtttgctaaatcgaaactagag
gaactgtccaggataatgcacgatgaagtgagtgacactgaaaacataaggaagaacctg
gccatagaaagaatgatcgtagagggctgtgatattttgctggacaccagccaaactttc
atccgccaaggttctcttattcaagtaccttctgttgagaggggaaaacttagtaaagtt
cgcctgggttcattgtctttgaaaaaggaaggagaaagacagtgcttcttatttacaaaa
cactttttaatttgtacaagaagttcaggaggaaagctacatctgctcaagacaggtggg
gttctctctctaatagaatgtacattgattgaggagcccgatgcaagtgatgatgactct
aaaggttctgggcaagtgtttggacacctggattttaaaatagtagtggagcctcctgat
tctgcccctttcactgtagtcttgttagcaccttcacgccaagagaaggctgcctggacg
agcgacataagtcagtgtgtggacaatatacggtgtaatggtttaatgactatagtattt
gaggagaattccaaagttactgtgccccatatgattaagtctgatgcccgtcttcacaaa
gatgacaccgacatttgcttcagtaaaacactcaactcctgcaaagtgccccagatccgc
tatgccagcgtggagcgcctcctggagcggctgacagacttacggtttctcagtatcgat
ttcctcaatacctttctgcacacctatcgtattttcactacggcagctgtggtgctggca
aaactttctgacatatacaagaggccttttacctccattcctgtcaggtcattggaattg
ttttttgctaccagccagaacaatagaggtgaacatttggtggatggcaaatccccacgc
ttgtgtcgcaaattctcttcccccccaccgctggctgtgtccaggacgtcctccccagtg
agggccagaaagctgtccttgacttctccattgaactcaaggataggagcgttggacctg
accacctgttcagcatccagtagtcctaccgccacccacagccccgctgcctccccacca
ccgcacaccgggaaagtaccgttggatcttagcagaggccttccttctccagagcaaagc
ccgggatctgtagaagagcacgtggataacccccgcatggatctgtgtaacaagctaaaa
cgaagtattcaaagagctgtccttgagtctgtccctgtggaccgagctggagtggaaggt
tccccggcggtggacagcacagacctttcaccttgccgatcaccttccacgcctcagcat
ctccgctatcgccagcctgtaggacagacggctgacaactcccactgctctgtttcgcct
gcttctgcttttgcaattgccacggcggctgcaggacatggaagtccaccaggatttaac
aacactgagaggacatgtgacaaagagtttattattcgaagaacagccaccaatcgagtc
ctgaatgtcctccgtcactgggtctcaaagcacgcacaggattttgaactcaacaacgaa
ctaaagatgaatgtcctaaatttgctagaagaagttttacgagacccagaccttcttccc
caggaaaggaaagccacggcgaatatcctgagggccctttcacaagatgatcaagatgac
atccacctaaaattagaggatataattcaactgacagactgtccgaaggctgagtgcttt
gagaccttgtcagccatggagctggctgagcagatcaccctcctggaccacatcatcttc
agaagcattccctacgaagaatttcttgggcaggggtggatgaagctggataaaaatgaa
agaacaccttacattatgaaaaccagccaacacttcaatgatatgagtaacctggtggcc
tcccagataatgaactatgcggacgtcagctcgagggccaacgcgatagagaagtgggtg
gccgtggcggacatctgccgatgcctgcacaactacaacggcgtgctggagatcacctca
gccttaaacagaagtgccatctaccggctgaagagaacctgggccaaggtgtccaagcag
acaaaagctctaatggacaagcttcagaagaccgtttcatctgaaggaagatttaaaaat
ctcagagaaacccttaaaaactgtaaccccccagctgttccttatctggggatgtacctg
acagacctggcctttattgaagaaggaacaccaaactttactgaggaaggcctcgttaat
ttctccaaaatgagaatgatatcacacatcatcagagagatacgccaattccagcagact
tgctatcgaatagaccatcagccaaagggagagctctgctttacaagaagaaacagcaaa
atacagagttcttggtacctgagcctattgcacctgctggtttctcttggaggcatgaag
tatattgatgctgacagtgaaaaaaaaaattga

DBGET integrated database retrieval system