KEGG   Canis familiaris (dog): 610373Help
Entry
610373            CDS       T01007                                 

Definition
chymotrypsinogen B1-like
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
cfa  Canis familiaris (dog)
Brite
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     610373
Peptidases [BR:cfa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   610373
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 268 aa AA seqDB search
MAFLWVVLGFLLFGSSSGCGVPAIHPQLSGLSRIINGEDAVPNSWPWQVSLQTSSGFHFC
GGSLISQHWVVTAAHCGVRKSHLVVAGVSDHSSTEEAVQVLPIAEVFEHPLWGQDLGPYD
IALLKLAAPALLSATASPVCLPGANASFPAGSLCATTGWGRTRYNSNKTPDKLQQAALPL
LSNAECKKFWGSKITDVMICAGASGVSSCMVGPALPSPPSPCPALPRPCSGREGSSSLRH
LLPLAQASCPGPAGAGLPGAMASSRQSP
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggcctttctctgggttgtccttggctttcttctctttggcagcagctcaggctgtggg
gtccctgccatccacccccagctgagtggcttgtcccggatcatcaatggagaggatgct
gtccccaactcctggccctggcaggtgtccctgcagactagctccggcttccacttctgc
gggggctccctcatcagccagcactgggtggtcacggccgcccactgcggggtcaggaag
agccacctggtggtggctggggtgtccgaccacagctctacggaggaggccgtgcaggtg
ttgcccatcgctgaggttttcgagcaccccctgtggggccaggatctgggcccctacgac
atcgcgctgctgaagctggccgcgcccgccctgctctcggccaccgcgtcccccgtgtgc
ctgcccggcgccaacgccagcttccccgcgggctccctctgcgccaccacgggctggggc
aggacccggtacaactccaacaagacgcccgacaagctgcagcaggcggccctgcccctc
ctgtccaacgccgagtgcaagaagttctggggcagcaagatcaccgacgtgatgatttgc
gccggtgccagcggcgtctcctcctgcatggtaggcccggctctgccctccccgccgtcg
ccctgccctgccctgcccaggccctgctcgggtcgggagggcagctcctctctgcggcac
ctgctccccctggcccaggccagctgccctggcccggctggtgcggggctcccgggggcg
atggcgtcctcccgccagtccccctga

DBGET integrated database retrieval system