KEGG   Canis familiaris (dog): 610398Help
Entry
610398            CDS       T01007                                 

Gene name
NPC1L1
Definition
NPC1 (Niemann-Pick disease, type C1, gene)-like 1
Orthology
K14461  
Niemann-Pick C1-like protein 1
Organism
cfa  Canis familiaris (dog)
Pathway
Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Organismal Systems
  Digestive system
   04975 Fat digestion and absorption
    610398 (NPC1L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 1325 aa AA seqDB search
MADTGLRGWLLWALLLHVAQSELYTPIHQPGYCAFYDECGKNPELSGGLAPLSNVSCLSN
TPALRVTGEHLTLLQRICPRLYTGTTTYACCSPKQLLSLETSLAVTKALLTRCPTCSDNF
VNLHCQNTCSPNQSLFINVTRVAGGGGGRPQAVVAYEAFYQDTFAQQTYDSCSRVRIPAA
ATLAVGTMCGVYGSTLCNAQRWLNFQGDTSNGLAPLDITFHLMEPGQALGSGMQALTGEI
RPCNESQGNGTVACSCQDCAASCPTIPQPQALDSTFYLGGLEGGLALVIILCSAFALLTT
FLVGTRLASSCGKDKTPDPKAGMSLSDKLSLSTNVILSQCFQNWGTWVASWPLTILLVSI
AVVLALSGGLAFVELTTDPVELWSAPSSQARSEKAFHDQHFGPFLRTNQVILTAPNRPSY
HYDSLLLGPKNFSGVLASDLLLELLELQETLRHLQVWSPEEQRHISLQDICFAPLNPHNA
SLSDCCINSLLQYFQSNRTHLLLTANQTLTGQTSQVDWRDHFLYCANAPLTFKDGTALAL
SCMADYGGPVFPFLAVGGYKGKDYSEAEALIMTFSLNNYAPGDPRLAQAKLWEAAFLEEM
KAFQRRTAGTFQVTFMAERSLEDEINRTTAEDLPIFGVSYIIIFLYISLALGSYSSWRRV
PVDSKVTLGLGGVAVVLGAVTAAMGFFSYLGVPSSLVILQVVPFLVLAVGADNIFIFVLE
YQRLPRRPGEPREAHIGRALGSVAPSMLLCSLSEAICFFLGALTPMPAVKTFALISGFAI
VLDFLLQVSAFVALLSLDSRRQEASRLDVCCCVSAPKLPAPGQSEGLLLRVFRKFYVPVL
LHRVTRAVVLLLFTGLFGVGLYFMCHIRVGLDQELALPKDSYLLDYFFFLNRYFEVGAPV
YFVTTGGYNFSSEAGMNAVCSSAGCDSYSLTQKIQYATEFPEESYLAIPASSWVDDFIDW
LTPSSCCRLYAFGANKDKFCPSTVNSLACLKNCVNFTLGPVRPSVDQFHKYLPWFLSDPP
NIKCPKGGLAAYNTSVHLGSDGQVLASRFMAYHKPLRNSEDYTEALRVSRALAANITAQL
RQVPGTDPAFEVFPYTITNVFYEQYLSVVPEGLFMLAICLLPTFVVCCLLLGMDLRSGLL
NLFSIVMILVDTVGFMALWGISYNAVSLINLVTAVGISVEFVSHITRSFAVSTRPTRLER
AKEATISMGSAVFAGVAMTNLPGILVLGLAKAQLIQIFFFRLNLLITVLGLLHGLVFLPV
VLSYLGPDINAALVLDQKKTEEAIGAPAHLVPTSTASSTYVNYGFQHPANGVVGDSSLPR
SGPDL
NT seq 3978 nt NT seq  +upstreamnt  +downstreamnt
atggcggacactggcctgaggggctggctgctatgggcactgctcctgcatgtggcccag
agtgagctgtacacacccatccaccagcctggctactgcgctttctacgacgagtgtggg
aagaacccagagctgtctgggggactggcgcctctgtctaatgtgtcctgcctgtccaac
acgcccgccctccgtgtcactggtgagcacctgaccctcctacagcgcatctgcccccgc
ctctacacgggcaccaccacctatgcctgctgctcccccaagcagctgctgtccctggag
acgagcctggcggtcaccaaggccctcctcacccgctgccccacctgctccgacaacttt
gtgaacctgcactgccaaaacacctgcagccccaaccaaagtctcttcatcaacgtgacc
cgcgtggctgggggcgggggtggccggccccaggctgtggtggcctatgaggccttctac
caggacacctttgcccagcagacctacgactcttgcagccgggtgcgcatccctgcggct
gccacgctggccgtgggcaccatgtgtggcgtttatggctccaccctctgcaatgctcag
cgctggctcaatttccagggggacacttcgaatggcctggctcccctagacatcaccttc
cacctgatggagcccggccaggccctagggagtgggatgcaggctctgaccggggagatc
aggccctgcaacgagtcccagggcaatggcacggtggcctgctcctgccaggactgtgct
gcgtcctgccccaccatcccccagccccaggcactggactccaccttctacctgggcggg
ctggaaggtgggctggcccttgtcatcatcctctgctctgcttttgccctgcttaccacc
ttcctggtgggtacccgcctggcctcctcctgtggcaaggacaagacgccagaccccaag
gcaggcatgagcctgtctgacaaactcagcctctccaccaacgtcatccttagccagtgc
ttccagaactggggcacatgggtggcctcatggccgctgaccatcctgttggtgtccatc
gccgtggtattggccttgtcaggaggcctggcctttgtggaactgaccacggacccagtg
gagctgtggtcggcccccagcagccaagcccggagtgagaaggctttccacgaccagcat
tttggccccttcctccgaaccaaccaggtgatcttgacggctcccaaccggcccagctac
cactacgactccctgctcctggggcccaagaacttcagtggggtcctggcctctgacctc
ctgctggagctgctggagctacaggagacgctgcggcacctccaggtgtggtcgcccgag
gagcagcgccacatctcgctgcaggacatctgcttcgcgcccctcaaccctcacaatgcc
agcctctccgactgctgcatcaacagcctcctgcagtatttccagagcaaccgcacgcac
ctgctgctcacggccaaccagacgctgacgggccagacctcccaggtggactggagggac
cactttctctactgtgctaacgccccactcaccttcaaggatggcacagccctagccctg
agctgcatggctgactatgggggccctgtcttccccttccttgccgtgggtggctacaaa
gggaaggactactctgaggcggaggccctgattatgaccttctccctcaacaactatgcc
cctggggacccccggctggcccaggctaagctctgggaggcagccttcttggaggagatg
aaagccttccagcggcggacagctggcactttccaggtcacattcatggctgagcgctcc
ctggaggacgagattaaccgcacgacggcggaggacctccccatcttcggagtcagctac
atcatcatcttcctgtacatctccctggcgctgggcagctactccagctggcgccgggtg
ccggtggactccaaggtcacgctgggcctgggcggggtggcggtggtgctgggagcagtg
acagcggccatgggcttcttctcctacctcggcgtgccgtcctccctggtgatccttcag
gtggtgcctttcctggtgttggccgtgggcgctgacaacatcttcatctttgttctggag
taccagaggctgccccggaggccgggagagccgcgggaggcccacatcggccgagcgctg
ggcagtgtggcccctagcatgttgctctgcagcctgtctgaggccatctgcttctttcta
ggggccctgacccctatgcccgctgtgaagacctttgccctgatctcgggctttgccatc
gtcctggacttcttgctgcaggtgtcagcctttgtggctctgctttctctggacagcagg
aggcaggaggcctcccgcttggacgtctgctgctgcgtgagcgccccgaagctgcctgca
cccggccagagcgagggactcctgcttcgagtcttccgcaagttctacgtcccagtcctg
ctgcaccgggtgacacgggcggtggtgctgctgctgttcaccggcctcttcggggtgggg
ctctacttcatgtgccacatccgcgtgggattggatcaggagctggccctgcccaaggac
tcatacctgctggactatttcttcttcctgaaccgctactttgaggtgggggctcccgtc
tactttgtcaccacgggaggctacaacttctccagcgaggcgggcatgaatgctgtgtgc
tccagtgccgggtgcgacagttactccttaacccagaagatccagtacgccaccgagttc
cccgaggagtcttacctggccatccctgcctcctcctgggtggatgacttcatcgactgg
ctgaccccgtcctcctgctgccgcctttatgcctttggtgctaataaggacaaattctgc
ccttcgactgtcaactccctagcctgcttgaagaactgcgtgaacttcacactgggccct
gtccggccatccgtggaccagttccacaagtaccttccctggttcctgagtgacccgccc
aacatcaagtgtcccaaaggtgggctggcagcgtacaacacctccgtgcatttgggatct
gatggccaggttttagcctcccggttcatggcctaccacaagccgctgcggaactcggag
gattacactgaggccctgcgggtgtcacgggcgctggcggccaacatcacggcccagctg
cggcaggtgccaggcaccgacccggccttcgaggtcttcccctacacgatcaccaacgtg
ttctacgagcagtacctgagcgtggtccccgagggcctcttcatgctcgccatctgcctg
ctgcccaccttcgtagtctgctgcctgctgctgggcatggacctacgctccggcctcctc
aacctgttctccatcgtcatgatcctcgtggacaccgtgggcttcatggccctgtggggc
atcagttacaatgccgtgtcgctcatcaacctggtcacggcggtgggcatctccgtggag
tttgtgtcccacatcacccgctcctttgcagtcagcacccggcccacccggctggagagg
gccaaggaggccaccatctccatgggcagcgcggtgtttgctggcgtggccatgaccaac
ctgccgggcatcctcgtcctgggcctggccaaggcacagctcatccagatcttcttcttc
cgcctcaacctcctcatcaccgtgctgggtctgctgcatggcctggtcttcctgccagtg
gtcctcagctacctcgggcctgatatcaatgcagctctcgtgctggaccagaagaagaca
gaagaggccatcggggcccctgcccacctggtcccaacatccacggccagcagcacctat
gtcaactacggcttccaacatcccgccaacggtgtagtgggcgacagttctctgccccgc
agtggaccggacctctga

DBGET integrated database retrieval system