KEGG   Canis familiaris (dog): 610429Help
Entry
610429            CDS       T01007                                 

Gene name
GRIK4
Definition
glutamate receptor, ionotropic, kainate 4
Orthology
K05204  
glutamate receptor, ionotropic kainate 4
Organism
cfa  Canis familiaris (dog)
Pathway
Neuroactive ligand-receptor interaction
Glutamatergic synapse
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:cfa04080]
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:cfa04724]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 956 aa AA seqDB search
MPRVSAPLVLLPAWLVMVACSPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERLG
KAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSSPASSSIISNICGEKEVPHFK
VAPEEFIKFQFQRFTTLNLHPSNTDISVAVAGILNFFNCTTACLICAKAECLLNLEKLLR
QFLISKDTLSVRMLDDTRDPTPLLKEIRDDKTATIIIHANASMSHTILLKAAELGMVSAY
YTYIFTNLEFSLQRMDSLVDDRVNILGFSIFNQSHAFFQEFAQSLNQSWQENCDHVPFTG
PALSSALLFDAVYAVVTAVQELNRSQEIGVKPLSCGSAQIWQHGTSLMNYLRMVELEGLT
GHIEFNSKGQRSNYALKILQFTRNGFRQIGQWHVADGLSMDSRLYASNISDSLFNTTLVV
TTILENPYLMLKGNHQEMEGNDRYEGFCVDMLKELAEILRFNYKIRLVGDGVYGVPEANG
TWTGMVGELIARKADLAVAGLTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFL
DPFSPGVWLFMLLAYLAVSCVLFLVARLTPYEWYSPHPCAQGRCNLLVNQYSLGNSLWFP
VGGFMQQGSTIAPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMDVPIESVDDLA
DQTAIEYGTIHGGSSMTFFQNSRYQTYQRMWNYMYSKQPSVFVKSTEEGIARVLNSNYAF
LLESTMNEYYRQRNCNLTQIGGLLDTKGYGIGMPVGSVFRDEFDLAILQLQENNRLEILK
RKWWEGGKCPKEEDHRAKGLGMENIGGIFVVLICGLIVAIFMAMLEFLWTLRHSEATEVS
VCQEMVTELRSIILCQDSVHPRRRRAGVPPPRPPVPEERRPRGTATLSNGKLCGAGEPDQ
LAQRLAQEAALVARGCTHIRVCPECRRFQGLRARPSPARSEESLEWEKTTNSSEPE
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atgccccgcgtctcggcgcctttggtgctgcttcccgcgtggctcgtgatggtcgcctgc
agcccgcactccttgaggatcgctgctatcttggatgaccccatggagtgcagcagaggg
gagcggctctccatcaccctggccaagaaccgcatcaaccgcgctcctgagaggctgggc
aaggccaaggtcgaagtggacatctttgagcttctcagagacagcgagtacgagaccgca
gaaaccatgtgtcagattctccccaagggggtggtcgctgtcctgggaccctcctccagc
ccggcctccagctccatcatcagcaacatctgtggggagaaggaggtccctcatttcaaa
gtggccccagaggagtttatcaagttccagttccagcgattcacaaccctgaacctccac
cccagcaacacggacatcagcgtggctgtagctgggatcctgaacttcttcaactgtacc
accgcctgcctcatctgtgccaaagcagaatgccttttaaacctggagaagctgctccgg
caattccttatctccaaggacacgctctcggtccggatgctggatgacacccgggacccc
accccactcctcaaggagatccgggacgacaagacagccaccatcatcatccatgccaac
gcctccatgtcccacaccatcctcctgaaggcagctgaactagggatggtgtcggcctat
tacacatacatcttcactaatctggagttctcgctccagagaatggacagcctggtggac
gatcgtgtcaacatcctgggattttccattttcaaccagtcgcatgctttcttccaagag
tttgcccagagcctcaaccagtcctggcaggagaactgtgaccatgtgcccttcactggg
cctgcgctgtcctcagccttgctgtttgatgccgtctatgctgtggtgaccgcggtacag
gagctcaaccggagccaggagatcggcgtgaagcccctgtcctgcggctcggcccagatc
tggcaacatggcacgagcctcatgaactacctgcgcatggtagaattggaaggtctcacc
ggccacattgaattcaacagcaaaggccagaggtccaactatgccttgaaaatcttacag
ttcaccaggaatggttttcggcagatcggccagtggcacgtggcggacggcctcagcatg
gacagccgcctctacgcctccaacatctccgacagcctcttcaacaccaccctggttgtc
accaccatcctggaaaacccgtatttaatgctgaaggggaaccaccaggagatggaaggc
aatgaccgctacgagggcttctgcgtggacatgctcaaggagctggcggagattctccgg
ttcaactacaagatccgcctggtcggggacggtgtgtacggtgttcctgaggccaacggt
acctggacaggaatggtcggggagctgatcgccaggaaagcagacctggccgtggcaggc
ctcaccattactgctgagcgggagaaggtgattgatttctccaagccattcatgactctg
ggaattagcattctttaccgagttcatatgggacgcaaacctggctatttctccttcctg
gacccattttctccgggcgtctggctcttcatgcttctagcctatctggccgtcagctgc
gtcctcttcctagtggctcggttgaccccctacgagtggtacagcccccacccgtgcgcc
cagggccgctgcaacctcctagtgaatcagtactcccttggcaacagcctctggtttcct
gttgggggcttcatgcagcagggttccaccatcgccccccgagccttatctacccgctgc
gtcagtggcgtctggtgggcattcacgctgattatcatctcatcctacacggccaacctg
gcagccttcctgactgtgcagcgcatggatgtgcccattgagtcggtggatgacctggct
gaccagaccgccattgagtatggcacaattcacggaggctccagcatgaccttcttccaa
aattcccgctatcagacctaccaacgcatgtggaattacatgtattctaagcagccaagt
gtgtttgtgaagagcacagaggagggaatagccagggtgttgaattccaactatgccttc
cttctggaatccaccatgaatgagtactaccggcagcgaaactgcaacctcactcagatt
ggagggctgctggacaccaagggctacgggatcggcatgccagtcggttcagttttccgg
gatgagtttgacctggccatcctccagctgcaggagaacaaccgcctagaaattctgaag
cgcaaatggtgggaaggcggcaagtgccccaaggaggaagatcacagagccaaaggactg
ggaatggagaatattggtggaatctttgtggttcttatttgtggcttaatcgtggccatt
tttatggctatgttggagtttttatggactctccggcactcagaagctactgaggtgtcc
gtctgccaggagatggtgaccgagctgcgcagcatcatcctgtgtcaggacagtgtgcac
ccccgccggcggcgcgccggggtgcctccgccgcggccccccgtccccgaggagcgccgg
ccgcggggcaccgcgacgctcagcaacggcaagctgtgcggggccggggagcccgaccag
ctggcgcagagactggcccaggaggccgccctggtggcccgcggctgcacgcacatccgc
gtctgccccgagtgccgccgcttccagggcctgcgcgcgcggccgtccccggcccgcagc
gaggagagcctggagtgggagaagaccaccaacagcagcgagcccgagtag

DBGET integrated database retrieval system