KEGG   Canis familiaris (dog): 610453Help
Entry
610453            CDS       T01007                                 

Gene name
PPP3R2
Definition
protein phosphatase 3, regulatory subunit B, beta
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
cfa  Canis familiaris (dog)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Oocyte meiosis
Apoptosis
Wnt signaling pathway
Axon guidance
VEGF signaling pathway
Osteoclast differentiation
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Long-term potentiation
Glutamatergic synapse
Oxytocin signaling pathway
Alzheimer's disease
Amyotrophic lateral sclerosis (ALS)
Amphetamine addiction
Tuberculosis
HTLV-I infection
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:cfa04010]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:cfa04310]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:cfa04370]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:cfa04020]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:cfa04114]
Cellular Processes; Cell growth and death; Apoptosis [PATH:cfa04210]
Organismal Systems; Immune system; Natural killer cell mediated cytotoxicity [PATH:cfa04650]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:cfa04660]
Organismal Systems; Immune system; B cell receptor signaling pathway [PATH:cfa04662]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:cfa04921]
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:cfa04724]
Organismal Systems; Nervous system; Long-term potentiation [PATH:cfa04720]
Organismal Systems; Development; Axon guidance [PATH:cfa04360]
Organismal Systems; Development; Osteoclast differentiation [PATH:cfa04380]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:cfa05010]
Human Diseases; Neurodegenerative diseases; Amyotrophic lateral sclerosis (ALS) [PATH:cfa05014]
Human Diseases; Substance dependence; Amphetamine addiction [PATH:cfa05031]
Human Diseases; Infectious diseases; Tuberculosis [PATH:cfa05152]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:cfa05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 175 aa AA seqDB search
MPACTMGNEASYPEEMCSHFSQDEIKRLGKRFKKLDLDCSGSLSVDEFLSLPELQQNPLV
QRVVDVFDTDGNGEVDFREFILGASQFSVRGDEEQKLRFAFSIYDMDKDGYISNGELFQV
LKMMVRDNLKDWQLQQLVDKTIITLDRDGDGKISFEEFSAVVGGLEVHKKLVVIV
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcgtgcacaatggggaacgaagccagttaccccgaggagatgtgctcccacttc
agccaggacgaaattaagaggctgggcaagcggttcaagaagctggacctagactgctcg
ggctccctgagcgtggacgagttcctgtcgctgcccgagctgcagcagaacccgctggtg
cagcgagtggtcgacgtcttcgacacggacggcaacggagaggtggacttcagggagttc
atcctgggggcctcccagttcagcgtcaggggggacgaggagcagaagctgaggtttgcc
ttcagcatctacgacatggataaagacggctacatctccaacggggagctgttccaggtg
ctgaagatgatggtccgggacaacctgaaagactggcagttacagcagctggtggacaag
accatcatcaccctggatagagacggggacgggaagatctccttcgaggagttcagtgct
gtggtcggaggcctggaggtgcacaagaagctggtagtaattgtgtga

DBGET integrated database retrieval system