KEGG   Canis familiaris (dog): 610829Help
Entry
610829            CDS       T01007                                 

Gene name
PFN4
Definition
profilin family, member 4
Orthology
K05759  
profilin
Organism
cfa  Canis familiaris (dog)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    610829 (PFN4)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    610829 (PFN4)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    610829 (PFN4)
Exosome [BR:cfa04147]
 Exosomal proteins
  Proteins found in most exosomes
   610829 (PFN4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
17
AA seq 129 aa AA seqDB search
MSHLQNLLLDTLLGTKHVDSAALIKLQERSLCVASPGFSVMPGDVRTLVNGFAKNPLQTR
REGLYFKEKDYKCIRADDYSLYAKNEKTGVVVVKTHLYLLVATYTEGMYPSVCVEATEKL
GEYLRRKGN
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatttgcagaacttactgttagataccctcctgggaacaaagcatgtggacagt
gcagcactcatcaaactccaggagcgaagcttgtgtgtggcatcgccaggatttagtgta
atgcctggtgatgtccgaacacttgtgaatggattcgccaagaaccctttacaaaccaga
agagaaggattgtatttcaaggaaaaggattacaaatgtatccgggcagatgactattct
ctttatgctaagaatgaaaaaactggtgtggtggttgtgaagacccatctatatcttctg
gtggcaacttacaccgaaggcatgtatcctagtgtttgtgtggaagccacagagaagcta
ggagaatatctaagaagaaaaggaaattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system