KEGG   Canis familiaris (dog): 611094Help
Entry
611094            CDS       T01007                                 

Gene name
MLL3
Definition
myeloid/lymphoid or mixed-lineage leukemia 3
Orthology
K09188  
histone-lysine N-methyltransferase MLL3 [EC:2.1.1.43]
Organism
cfa  Canis familiaris (dog)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:cfa00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
16
AA seq 4815 aa AA seqDB search
MDGLETTETENIVETAEIKEQSAEEDAEAEVDNSKRPIPVLQRSVSEESASSLVSVGVEA
KISEQLCAFCYCGEKSSLGQGDLKQFRVTPGFILPWKSQPSNKKDVDDNSNGTCERIQNS
APRKQRGQRKERSPLQNIVSCVSVSTQTASDDQAGKLWDELSLVGLPDAIDVQALFDPTG
TCWAHHRCVEWSLGVCQMEEPLLVNVDKAVVSGSTERCAFCKHLGATIKCCEEKCTQIYH
YPCAAGAGTFQDFRNFFLLCPEHIDQAPERSKEDANCAVCDSPGDLLDQFFCTTCGQHYH
GMCLDIAVTPLKRAGWQCPECKVCQNCKETGKNTFVLFCFTCSLNYNPFCVSPLVRIVPT
NLFTQCRNCRICVECGTRSSSQWHHNCLVCDSCYQQQDNLCPFCGKCYHPELQKDMLHCN
MCKRWVHLECDKPTDHELDSQFKEEYICMYCKHIAAEMDPLQAGDEVVMAEVTTDYNNEM
EVEGPEDHMVFPEQAINKDISDQESTPGIVPDAVHIPTEEQQQNNPPESLDTHGLLISES
SQDKMNPEVENQISHEVDSEKMEMSSKVMHIFDDQNENKMEVTENIEVRTHQIIVPHEDL
QLEESKMLASIEESRPPKSATESAIVPPDTVVSPCEQSTSLCSKEQLVIERVQEEMEQKT
GSESSTAFTDFGMAPAVENCVKDGLCREDKPVKLPSETELSFVSAADISKANVSSSLSSD
LPSQDILHTYPSTLSASVGNIMPTTYISVTPKIGMGKPAITKRKFSPGRPRSKQGRGSGF
PGKRRPRGAGLSGRGGRGRSKLKSGIGAVVLPGVSATDVSSNKDEEENSMHNTVVLFSSS
DKFTLHQDMCVVCGSFGQGAEGRLLACSQCGQCYHPYCVSIKITKVVLSKGWRCLECTVC
EACGKASDPGRLLLCDDCDISYHTYCLAPPLQTVPKGGWKCKWCVWCRHCGATSAGLRCE
WQNNYTQCAPCASLSSCPVCCRNYREDDLILQCRQCDRWMHAVCQNLNTEEEVENVADIG
FDCSMCRPYMPTSNVPSSDCCESSLVAQIVTKVKELDPPKTYTQDGVCLTESGMTQLQSL
TVTVPRRKRSKPKLKLKIINQNSVAVLQTPPDIQSEHSRDGEMDDSREGELLDCDGKSES
SPEREAVDDETKGVEGTDGVKKRKRKPYRPGIGGFMVRQRSRTGQGKTKRSVIRKDSSGS
ISEQLPNRDDGWSEHLPDTLVDESVSVTENTEKIKKRYRKRKNKLEETFPAYLQEAFFGK
DLLDTSRQNKLSLDNLSEDTAHLSYKTNMNTNFLDPSLDPLLSSSSTPAKPGPHDIGPVT
DDPSSLPQSSVNPSSRPLSEEQLDGILSPELDKMVTDGAILGKLYKIPELGGKDVEDLFT
AVLSPTATQPPPPPTPQLLPMHSQDVFSRMPLMNGLIGPSPHLPHNSLPPGSGLGTFSAI
AQSPYTDARDKNPAFNPMASDANSAWTSSAPAVEGENDTMSNAQRSALKWEKEEALGEMA
TVAPVLYTNINFPNLKEEFPDWTTRVKQIAKLWRKASSQERAPYVQKARDNRAALRINKV
QMSNDPLKRQQQQDSIDPGSRIDSDLFKDPLKQRESEHEQEWKFRQQMRQKSKQQAKIEA
TQKLEQVKNEQQQQQQQQQQFGAQPLLAQSGSDTPSSGMQSPLTPQPGNGNVSPAQSFHK
DLFTKQLPSTPTSASSDDVFVKPQAPPPAATPSRVSIQEGLPQSQACQPASPQVFSPGSS
HSRPPSPMDPYAKMVGTPRPAPGGHSFSRRNSAAPADSCTPLPSVSRPAQMTDTTANRPS
PVRDLCSSSTTNTDPYAKPPDTPRPVMTDQFPKPLGLPRSPVVSEQTAKGPLTAGTNDHF
TKPSPRADVFQRQRIPDPYARPLLTPAPLDSGPGPFKTPMQPPPSSQDPYGSVSQPRRLS
IDPYERPALTPRPIDNFSHNQSSDPYSQPPLTPHPAMNESFAHPSRAFSQPGTISRPTSQ
DPYSQPPGTPRPVVDSYSQPSGTSRSNPDPYSQPPGTPRPTTIDPYSQQPPTPRPSAQAD
LFVTSATNQRHSDPYGHPPGTPRPGISVPYSQPPATPRPRMSEGFPRSSMTRPVLMPNQD
PFLQAAQTRGAALSGPLIRPPDACSQTPRPPGPSLSDTFTRVSPSATRDPYDQPPMTPRS
QSDSFGTSQVSHDIVDQSRPGSEGSFSAPSNSPMSSQSQQFSNVSHLPGPIPTSGVTDTQ
NTVNMSQADTEKLRQRQKLREIILQQQQQKKMAGRQEKGSQDPAAVPHPAPLQHWQPESI
SQAFTRPPPPYPGNIRSPVGPPLGPRYAVFPKDTRGPYPPDVTGMGMRPHGFRFGFPGAS
HGTLSSQERFLVPPQQIQGSGVPPQLRRSISVDMPRPLNNSQMNNPVGLPQHFPPQSLPV
QQHNILGQAFIELRHRAPDGRPRLPFSASPSSVIEAPSHPRHGNFIPRPDFPGPRHTEPL
RRPSQGLPTQLPLHPNLEQVPPSQQDQGHPAHSSSMVMRSLNHPVGGEFSEASLSTSTPA
ETTSDNLQMTTSSSEGLEEKLDSDDPSVRXLDVKDLEGVEVXDLDDEDLENLNLDTEDGK
GDELDTLGNLETNDPNLDDLLRSGEFDIIAYTDPELDLGDKKSMFNEELDLNVPIDDKID
NQCVSIEPKKKEQEDKTMVPPDKHSPWKKSVGTSEIKTEVLSPNSKGETKCESEKSEESK
DNVDTPCSQASAHTDINDGEKASLQSCDTDLLEKRTNRETAVSSTSGVLGSTQLPAEDVI
NSCGITGTTPVLSSLLANEKSDNSDIRPLGSPPPTLPASPSNHVSNLPPPLMTPPGHVLD
NTMNSNVTVVSRVNHTFPQGVQVNPGFIQGQSTVNHGFGTGKPTNQTMPLTSQSGTSGMS
GPQQLMIPQTLAQQNRERPLLLEEQPLLLQDLLDQERQEQQQQRQMQAMIRQRSEPFFPN
IDFDAITDPIMKAKMVALKGINKVMAQNNMGMPPMVMNRFPFMGQSVTGTQTSEGQSLLP
QAIAQDGSITHQISRPNPPNFGPGFVNDSQRKQYEEWLQETQQLLQMQQKYLEEQIGAHR
KSKKALSAKQRTAKKAGREFPEEDAEQLKHVTEQQSMVQKQLEQIRKQQKEHAELIEDYR
IKQQQQQQQQQQQQQQCALAPPAVMPGVQPQPPLVPGATPPAMSQPSFPMVPQQLQHQQH
PAVISGHSSPARMPSLPGWQPASAPAHLPLNPARIPPPVAQLPIRTCTPAPGTVSSVNPQ
SGPPPRVEFDDNNPFSESFQERERKERLREQQERQRIQLMQEVDRQRALQQGVGMQQHGP
LRSQMPFYGSDLPCDFTQPPRPLQQSPQPQQQMGQGSQQQSIQQGSMNSPPTQTFLQTNE
RRQIGPPSFLSDSPSIPGGSPNFHSVKQVHGGLSGTSFQQSPVRPPFTPALPAAPVATNS
SLPCGQDPVATHGQSYPGSAQSLIQLYSDIIPEEKGKKKRTRKKKKDEDVESTRAPSTPH
SDITAPPTPSISETTSTPTVNTPGELPPQVEPESMEPVCPSTPNMAASQLGTELENKLPQ
TDLSQGTPNPQTYANPEVDKLSMETPAAAEEVKVETTEPLQCPGQDGPDREEQTGNEAEG
RAVAGPVSSAQSPPHSAGAPAAKGDSGNELLKHLLKNKKSSSLLSQKPEGSFSEDDCTKD
KLVERQNPVEGLQTLGAQMQGGFGCGNNQLPKTDGGSETKKPRSKRTQRTGEKAAPRSKK
RKKDEEEKQAMYSTTDTFTHLKQQLSLLPLMEPIIGVNFAHFLPYGSGQFNSGSRLLGTF
GSATLEGVSDYYSQLIYKQNNLSNPPTPPASLPPTPPPMACQKMANGFATTEELAGRAGV
LMSHEVTKSLGPKPFQLPFRPQDDLLARAIAQGPKTVDVPASLPTPPHNNQEELRIQDHG
GDRDTPDSFVPSSSPESVVGMEVSRYPDLSLVKEEPPEPVPSPIIPILPSSAGKGLESRR
NDIKTEPGTLFFTPPFGSSPNGPRSGLISVAITLHPTAAENISSVVAAFSDLLHVRIPNS
YEVSNAPDVPSMGLVSSHRVNPGLECRQHLFLRGPPPGPANPPRLASSYRLKQPDGPFPP
TSNGFSGYKDPSHGIAESTALRPQWCCHCKVVILGSGVRKSFRDLAFVSKDSRESSNRME
KDIVFCSNNCFVLYASTTQAKNSESKESAPPMMQSPVKEMPSKAFHQYSNNISTLDVHCL
PQLQEEVSPPASPPITFPPAFEAAKVEAKPDELKVTVKLKPRLRTVHGGFEDCRPINKKW
RGMKWKKWSIHIVIPKGXFQPPCEDEIDEFLKKLGTSLKPDPVPKDYRKCCFCHEEGDGL
TDGPARLLNLDLDLWVHLNCALWSTEVYETQAGALINVELALRRGLQMKCVFCHKMGATS
GCHRFRCTNIYHFTCAIKAQCMFFKDKTMLCPMHKPKGIHEQELSYFAVFRRVYVQRDEV
RQIASIVQRGERDHTFRVGSLIFHTIGQLLPQQMQAFHSPKALFPVGYEASRLYWSTRYA
NRRCRYLCSIEEKDGRPVFVIRIVEQGHEDLVLSDSSPKGVWDKILEPVACVRKQSEMLQ
LFPAYLKGEDLFGLTVSAVARIAESLPGVEACENYTFRYGRNPLMELPLAVNPTGCARSE
PKMSAHVKRPHTLNSTSTSKSFQSTVTGELNAPYSKQFVHSKSSQYRKMKTEWKSNVYLA
RSRIQGLGLYAARDIEKHTMVIEYIGTIIRNEVANRKEKLYESQNRGVYMFRMDNDHVID
ATLTGGPARYINHSCAPNCVAEVVTFERGHKIIISSNRRIQKGEELCYDYKFDFEDDQHK
IPCHCGAVNCRKWMN
NT seq 14448 nt NT seq  +upstreamnt  +downstreamnt
atggatggactggagacaacagaaacagaaaatattgtggaaacagcagaaatcaaagaa
caatctgcagaagaggatgctgaagcagaagtggacaacagcaaacggccgatcccagtt
cttcagcgttctgtgtctgaggaatctgcgagctccctggtctctgttggtgtagaagcc
aaaatcagtgaacagctctgcgctttttgttactgtggtgaaaaaagttccttaggacaa
ggagacttaaaacaatttagagtaacgcctgggtttatcttgccatggaaaagccagcct
tctaacaagaaggacgttgatgacaacagcaatggcacctgtgagagaatacaaaactca
gcaccgcgaaaacaaagaggacagagaaaagaacgatctcctctgcagaatatagtctct
tgtgtaagtgtaagcactcagaccgcttccgatgatcaggctggcaaactgtgggatgag
ctcagtctggttggccttcccgatgccatcgatgtccaggccttgtttgatcccacaggc
acttgttgggctcatcatcgttgtgtggagtggtcactaggagtgtgccagatggaggaa
ccattgttagtaaatgtggataaagctgttgtctcagggagcacagaacgatgtgcattt
tgtaagcaccttggagccactatcaaatgctgtgaagagaaatgcacccagatataccat
tatccttgtgctgctggagctggtacctttcaggacttcaggaacttcttccttctgtgt
ccagagcacattgaccaagctcctgaaagatcaaaggaagatgcaaactgtgcagtgtgc
gacagcccgggagacctcttagatcagttcttttgtactacttgtggtcagcactatcat
ggaatgtgcctggatatagcggttactccattaaaacgggcaggttggcaatgccctgag
tgcaaagtgtgccagaactgcaaagagactgggaaaaatacctttgttttgttttgtttt
acatgttcacttaattataatcctttctgtgtttctcctttggtaaggatagtgcccacc
aatttgtttacacaatgcagaaattgcagaatatgtgtagagtgtggcacacgatctagt
tctcagtggcaccacaattgcttggtatgtgacagttgttaccaacaacaggataactta
tgtcctttctgtgggaagtgctaccatccagaattgcagaaagacatgcttcattgtaat
atgtgcaaaaggtgggttcacttagaatgtgacaaaccaacagatcatgagctggattct
cagttcaaagaagagtatatctgcatgtattgtaaacacatagcagctgagatggatcca
ttacaggcaggtgatgaagtggtgatggctgaagtcactacagattataacaatgagatg
gaggttgaaggacctgaggaccatatggtatttccagagcaagcaattaataaagacatc
agtgatcaggagtccacacctggaattgttccagatgcagttcacatccccacagaagag
cagcagcagaataatccaccagaaagtcttgatacacatggtcttctcatttctgaatca
tcgcaagataaaatgaaccctgaagtggaaaatcagatttctcatgaagttgatagtgaa
aaaatggaaatgtcttctaaagtgatgcatatttttgacgatcaaaatgaaaacaaaatg
gaagtgacagaaaacattgaagtccgtacacaccagatcattgtgccgcacgaggatctg
cagttagaggaatccaaaatgctggcatccatagaagaatctcggcctccaaaatcagcc
actgaatctgccattgttccaccggacactgtggtgtccccgtgtgagcaaagtacttct
ttatgttctaaggaacagttggttatagaaagggtacaagaagaaatggaacagaaaaca
ggttctgaatcttccactgcatttacggactttggaatggctcctgcagttgagaattgt
gtgaaagatggtttatgccgagaagacaaacctgtaaaactaccatctgagacagagttg
tcatttgtgtcagctgcagacataagcaaggcaaatgtgtcttcctctctttcttcagac
ttgccttcccaggatatactgcacacttacccttcaaccctcagtgcttctgttggaaac
attatgccaacaacatatatctcagtcactccaaaaatcggcatgggtaaaccagctatt
accaaaagaaaattttctcctggtagacctcggtccaaacagggccgtgggtcaggattt
ccaggaaagcgaagaccccgtggtgcggggttgtcaggacgaggtggcagaggcaggtca
aaattgaaaagtggaattggagcagttgtgttacctggggtgtctgctacagatgtttca
tcgaataaggatgaagaagaaaactccatgcacaacacggtggtgctgttttctagcagc
gacaagttcaccttgcaccaggatatgtgtgtagtttgtggcagtttcggccaaggggca
gagggaagactgcttgcctgctctcagtgtggccagtgttaccatccgtactgtgtcagt
attaagatcaccaaagtcgttcttagcaaaggttggaggtgtttggaatgcaccgtgtgt
gaagcttgtgggaaggcgagtgaccccggacggctcctgctctgtgatgactgtgacata
agctaccacacctactgcctcgcccctcctctgcagaccgtgcccaaggggggctggaag
tgcaaatggtgtgtttggtgccgacactgtggagccacgtctgcaggcctgagatgtgag
tggcagaacaattacacacagtgcgctccctgtgcaagcttgtcttcctgccccgtctgc
tgtcggaactatcgagaagacgacctcattctacagtgtagacagtgcgatagatggatg
catgcagtttgtcaaaacttaaatacagaagaggaagtggaaaatgtagcagacattggt
tttgattgtagcatgtgcagaccctatatgcctacgtcaaatgtgccttcctcagactgc
tgtgaatcttcacttgtagcacagattgtcacaaaagtgaaagaactagatccacccaag
acatacacccaggatggtgtgtgtttgactgaatcagggatgactcagttacaaagcctc
acagtcacagttccacgaagaaaacggtcaaaaccaaagttgaagttgaagattataaat
cagaatagcgtggctgtccttcagactcctccagacatccagtcagaacattcaagggat
ggagaaatggatgatagtcgagaaggagaacttctggactgtgatgggaaatcagaatcc
agtcctgaacgggaagcagtggacgatgaaactaagggggtcgaaggaacagacggtgtg
aaaaagagaaaaaggaaaccgtacagaccaggtattggtggatttatggtacggcaaaga
agtcgaactgggcaagggaaaacgaaaagatctgtcatcagaaaagattcctcaggctct
atttctgagcaattacctaacagagatgatggctggagtgagcacttaccagatactcta
gttgatgaatctgtttctgttactgaaaacactgaaaaaataaagaagagataccgaaaa
cggaaaaataagcttgaagaaactttccctgcctatttacaagaagctttctttggaaaa
gatcttctagatacaagtagacaaaacaagctaagtttagataatctatcagaagataca
gctcacctttcatataaaacaaacatgaacacaaatttcttggatccttccttagatcca
ctacttagttcatcctcaactccagcaaaacctggacctcacgatattggtcctgtcacc
gatgatccatcgtctttgcctcagtcaagtgtcaatccgagttcacgaccattaagtgaa
gagcagctagatggaatcctcagtcccgagctagacaaaatggtcacagatggagcaatt
cttggaaagttatataaaattccagagcttggagggaaggatgttgaagacttgttcaca
gctgtgctcagtcctacagccacacagccgcccccacccccaacgccacagctactgccc
atgcacagtcaggatgttttttcccggatgccactcatgaatggccttattggacccagt
cctcatctcccacataattctttgcctcctggaagtggattggggactttctctgccata
gcacaatctccttacactgatgccagggataaaaatccagcatttaatccaatggctagt
gatgctaatagtgcttggacatcctcagctcccgctgtggaaggagagaatgatacaatg
tcaaatgcccagagaagtgcactgaagtgggagaaggaagaggctctgggtgaaatggca
acggtagcaccggttctctacacaaacattaacttccccaacctcaaggaagaattccct
gactggactactagagtgaagcagatcgccaagctgtggagaaaagcaagctcacaggaa
agagcgccttatgtgcaaaaagccagggataacagagctgctttacgcattaataaagta
cagatgtcaaatgatcccctgaagaggcaacaacagcaagatagcatcgatcctggttcc
cgcattgattcggacctttttaaagatccattaaagcaaagagaatcagaacatgaacag
gaatggaaatttagacagcaaatgcgtcagaagagtaagcagcaagctaaaattgaagcc
actcagaaactggaacaggtgaagaatgagcagcagcagcagcagcagcagcagcagcag
tttggagcccagcctctcctggcccagtccggctctgacacacccagcagtgggatgcag
agccccttgaccccccagcccggcaatggaaatgtgtctcctgcacagtcattccataaa
gacctgtttacaaagcagctacccagcacccccacttctgcatcgtcagatgatgtgttt
gtgaaaccacaggctcctcctcctgcggcaaccccgtcccgcgtgtccattcaggagggg
ctgccacagtctcaggcttgtcagccagcctccccacaggtgttttcaccgggatcttct
cattcccgaccgccatctcccatggatccttatgcgaaaatggttggtaccccaagacca
gctcctgggggccatagtttttccagaagaaattctgctgcaccggcagacagctgcacc
cctctgccttcagtgtctaggcctgctcagatgactgacactacagcaaacaggccatcc
ccagtcagagatctgtgttcttcctccacaacaaatactgacccctatgcaaagcctcca
gacacacctagacctgtgatgacagatcagtttcccaaacccttgggcctccctaggtct
cctgtagtttctgaacagactgcaaagggtcctctaacagctggaaccaatgatcacttt
actaaaccatctcctagggcagatgtatttcaaagacaacggatacctgacccatatgca
cgacccttgttgacacctgcccctcttgatagtggtcctggaccttttaagactccaatg
cagccccctccgtcttcccaggatccctatggatcagtgtcacaaccaaggcgattgtct
attgatccttatgagaggcctgctttgacaccaagacctatagataacttttctcataac
cagtcaagtgacccatatagccagcctcctctgaccccacatccggcgatgaatgaatct
tttgcccatccttcaagggctttttcccagcctggaaccatatcaaggccaacatctcag
gacccatattcccaacccccaggaactccgcgacctgttgtagattcttattcccaaccc
tcaggaacatctcgctccaatccagatccttactctcaacctcctggaactccccggccc
accaccattgatccttatagtcagcagccaccaaccccaagaccatctgcacaggcagac
ttgtttgttacatctgccactaatcagaggcattcggatccatatggtcatcctcctgga
acaccaagacctgggatatctgttccttactctcagccaccagcaacaccaaggccaagg
atgtcggagggttttcctaggtcctcaatgacaagaccagtcctaatgccaaatcaggat
cctttcctacaagcagcacaaactcgcggagcagctctctctggcccattgataaggcca
cctgatgcatgttctcaaacaccaaggccaccaggacctagtctttcagacacgtttacc
cgagtctccccatctgctactcgtgatccctatgaccagcctccaatgactccaagatct
cagtctgactcttttggaacaagtcaagtttctcatgatattgttgatcagtcaagacct
ggatcagaggggagtttcagtgcaccttctaactctccaatgagttctcaaagccaacag
ttttccaatgtctcccatcttcctggtcccataccaacctcaggagtcactgatacacag
aataccgtaaatatgtcacaagcagatacagagaaactgagacagcggcaaaagttacgt
gaaatcattctccagcagcagcagcagaagaagatggcaggtcgacaggagaaagggtcc
caggatccagcagcagtacctcatcccgcacccctgcagcactggcagcctgagagtata
agccaggcttttactaggcctccacccccctatcctgggaacatccgatcacctgttggc
cctcctctaggacctagatatgcagttttcccaaaagatacacgtggaccctatcctcct
gatgttactggtatggggatgagacctcatggatttagatttggatttccaggagctagt
catggtaccctgtcaagtcaggaacgcttccttgtacctcctcaacaaatacaaggatct
ggagttcctccacagctaagaagatcgatatctgtagatatgccgaggcctttaaataac
tcacaaatgaataatccagttggccttcctcagcattttccaccacagagcctgccagtt
cagcagcataacatactgggccaagcatttattgaattgagacatagggcccctgatgga
aggccacggctgcccttcagtgcttctcccagcagtgttatagaggcaccttctcatcca
aggcatggaaacttcattccccggccagactttccaggccctagacacacagagcccttg
agacgaccttctcaaggtctaccaactcagctgcctttgcatccaaacttggaacaagtg
ccaccatctcagcaagaccaaggtcatcctgcccattcatcttctatggtcatgaggtct
ctaaatcatcccgtaggtggcgaattttccgaggcctctttgtcaacatctacaccagct
gaaacaacatctgataatttacagatgaccacctcatcttctgagggtctcgaagaaaaa
cttgattctgatgacccatctgtaaggnnactagatgttaaagatcttgagggtgttgaa
gtcntagacttggatgatgaagatcttgaaaatttaaatctagatacagaggatggcaag
ggagatgaattggatactttgggtaatttggaaaccaatgatcccaacctggatgacctc
ttaagatcaggagaatttgatatcattgcatatacagatccagaacttgacctaggagat
aagaaaagcatgtttaatgaggaactagaccttaatgttccaattgatgataagatagat
aatcagtgtgtatctattgaaccaaaaaaaaaggagcaagaggacaaaactatggttcct
cctgataaacattctccatggaaaaaatctgtgggtactagtgagataaaaacagaagta
ctgtctccaaattctaaaggggaaactaaatgtgaaagtgagaaaagtgaagagagtaaa
gataatgttgacactccctgctcacaggcttctgctcacacagacataaatgatggagaa
aaggcttctttgcagtcctgtgatacagatctacttgagaaaagaactaatcgagaaact
gctgtctccagcacaagtggtgttcttggctccactcagctgcctgctgaggatgtaata
aactcttgtggcataactggaacaactccagttctctcaagtttacttgctaatgaaaaa
tctgataattcagacattaggccattggggtctccaccaccaactttgccagcctcacca
tccaaccatgtgtcaaatttgccacctcctttaatgacaccacctggtcacgttttggat
aataccatgaattctaatgtgacagtagtctctagagtaaatcatacttttcctcagggt
gtgcaggtaaatccaggattcattcaggggcagtcaacagttaatcatggttttgggaca
ggaaagcctacaaatcagactatgcctctaacaagccagtctggtaccagtggcatgtct
ggacctcagcaactaatgatccctcagaccttagcccagcagaatagagagaggcccctg
cttctggaggaacagcctctacttctgcaggatcttctggatcaagagagacaagaacag
caacagcagagacagatgcaagccatgattcgccagcggtcagagccgttcttccctaat
atcgattttgatgcaattacagatcctataatgaaagccaaaatggtggcacttaaaggc
ataaataaagtaatggcacaaaacaacatgggcatgccaccaatggttatgaacaggttc
ccctttatgggccagtccgtgactggaacgcagactagtgaaggccagagtctcctcccc
caggcaattgcgcaggatggcagtataacacatcagatttctaggcctaatcctccaaat
tttggtccaggctttgtcaatgattcacaacgtaagcagtatgaagaatggcttcaggag
acccaacagcttcttcagatgcagcagaaatatcttgaagaacaaatcggtgcacacaga
aaatctaagaaggccctttcagcaaaacaacgtactgccaagaaagctgggcgtgagttt
ccagaagaggatgcagaacaactgaagcatgttactgaacagcaaagcatggttcagaaa
cagctagaacagatccgtaaacagcagaaagagcatgctgagttgattgaagattatcgg
atcaagcagcagcagcagcagcagcagcagcaacagcagcagcagcaatgtgccctggcc
ccacctgccgtgatgccaggcgtccagccccaaccacccctcgttccaggtgccactccc
cctgccatgagccagcccagcttccccatggtgccacagcaactgcagcaccagcagcac
ccagcggtcatttctgggcatagcagccctgctagaatgcccagtttacctggctggcag
cctgccagtgctcctgcccacctgcccctcaaccctgctaggattccgcctccagttgcc
cagttaccaataagaacttgcacaccagcaccagggacggtgtccagtgtaaatccacag
agtggaccaccaccacgggtggaatttgatgacaataaccccttcagcgaaagtttccag
gaacgggaacgaaaggaacgcttacgggaacagcaggaaagacagcgcatccagctcatg
caggaggtcgacaggcagagggctctgcagcagggggtgggcatgcaacagcatggccca
ctgcgctcccagatgccgttctacggttctgacctgccttgtgacttcacccagcctccc
aggccccttcagcaatctccacagccccaacagcaaatggggcagggctcacagcagcag
agtatacaacaaggatctatgaattcccctcccactcagactttcctgcaaaccaacgag
cgaaggcagataggacctccctcattcctttctgactcgccatcgattcctggtggaagc
ccaaatttccattctgtgaagcaggtgcatggagggctttctgggaccagcttccagcaa
tccccagtgaggcctccgttcacacctgctttacctgcagcacctgtagcaaccaatagc
agtctcccttgcggccaagaccctgtagcaacccacggacagagttatccgggatcagcc
cagtctctcatccagttgtattccgacataatcccagaagaaaaagggaaaaagaaaaga
acaagaaagaagaagaaagatgaggatgtggagtccactagggctccatccaccccccac
tcagatataactgctccacccaccccaagcatctcagaaactacctccacaccaacagtg
aacacacccggcgagctgcccccacaagtcgaacctgagtcaatggagcctgtctgccca
tcaactcctaacatggcagccagccaactgggtacagaattagaaaacaagctgccccaa
actgatttatcacagggaactccaaatccacagacttatgcaaacccggaggtggataag
ctctccatggaaacccctgctgcagctgaagaggtaaaagtagagaccactgaaccactg
cagtgccctggccaagatgggcctgaccgggaggaacagacggggaacgaggctgaagga
agagctgtggctggtcctgtctcctcagcacagagtcctcctcattctgctggggcccct
gctgccaagggagactcaggcaatgaacttctgaagcatctgctgaaaaataaaaaatca
tcttcccttttaagtcaaaaaccagaaggcagcttttcagaagatgactgtacaaaggat
aaactagttgagaggcagaacccagtcgaaggattgcaaactttgggggctcagatgcaa
ggtggttttggatgtggcaacaaccaattgccaaaaacagatggaggaagtgaaaccaag
aaacctcgaagcaaacggactcaaaggacaggggagaaggctgcacctcgctccaagaaa
aggaagaaggatgaagaggagaaacaagctatgtactccaccactgacacctttacccac
ctgaagcagcagctctctctgctccctctaatggaaccaatcattggagtgaactttgcg
cactttcttccttatggcagtggccaatttaatagtgggagccgacttctaggaactttt
ggcagtgctacccttgaaggggtttcggattactattctcagttgatctacaagcagaat
aatttaagtaatcctccaacaccccctgcctctcttcctcctacaccacctcctatggct
tgtcagaagatggcaaatggttttgcgacaactgaagaacttgctggaagagccggcgta
ttaatgagccatgaagttaccaaaagcctaggacctaaaccatttcagctgccattcaga
ccacaggatgacttgttagccagagctattgctcaaggcccaaagacagttgatgttcca
gcctcattgccaacaccacctcataataatcaggaagaattaaggatacaggatcatggt
ggtgaccgggatactcctgacagctttgttccctcctcctctcctgagagcgtggtcggg
atggaagtcagcaggtacccagatttgtcgttggtcaaagaggagcctccagagcctgtg
ccatcccctattattcctattcttcctagcagtgctgggaaaggtttggaatctagaagg
aatgacatcaaaactgagccaggcactttatttttcacaccaccttttggttcatcccca
aatggtcccagatcaggtcttatatctgtggcaattactctgcatcctacagctgctgag
aacattagcagtgtggtggctgcattttccgaccttcttcacgtccgaatccctaatagc
tatgaggttagtaatgctccagatgttccatccatgggtttggtcagtagccacagagta
aacccaggtttggagtgtcgacagcatttatttcttcgtgggcctccgccaggacctgca
aaccctcccagattagcaagctcttaccggctgaagcaacctgatgggccattccctcca
acaagcaatggtttttctggatataaggatcctagtcatggtattgcagaaagcacggca
ctcagaccacagtggtgctgtcactgcaaagtggttattctgggaagtggtgtgaggaaa
tctttcagagatctggcctttgtgagcaaggattcccgagaaagctctaatagaatggag
aaggacatcgtcttttgtagtaataactgcttcgttctttatgcatcaaccacacaagca
aaaaactcagaaagcaaggaatccgcccctccaatgatgcagtctccggtgaaagagatg
ccttccaaagcctttcaccagtacagcaacaacatctccactcttgatgtgcactgcctc
ccgcagcttcaggaggaagtgtctcccccggcatcaccccccatcacattccctccggcg
tttgaagcagccaaagtagaggcaaagccagatgagctcaaggtaacagtcaagttaaag
cctcggctcagaactgtccacggcgggtttgaagattgtaggccgatcaataaaaagtgg
agagggatgaagtggaaaaagtggagcattcacatcgtaatccccaaggggnagtttcaa
cccccgtgtgaggatgaaatagatgagtttctgaagaagttgggcacttcccttaaacct
gaccctgtgcctaaagactaccggaagtgttgtttttgtcacgaggaaggtgatggattg
acagacgggccagcgagactgctcaaccttgacttagacctgtgggtccacttgaattgt
gcgctgtggtccacggaggtctatgagacccaggctggggccctgataaacgtggagctg
gcgctaaggaggggtctgcagatgaaatgtgtcttctgccataaaatgggtgccaccagc
ggatgtcaccgatttcggtgtaccaacatctatcactttacttgcgccattaaagcacaa
tgcatgttttttaaggataaaactatgctttgtcccatgcacaaaccaaaggggattcat
gagcaggaattaagttactttgcagtcttcaggcgggtctatgttcaacgtgatgaggtg
cgacaaatcgccagcatcgtgcagcgtggggagcgtgaccacaccttccgtgttggaagc
ctcatcttccatacgattggtcagctgctgccacagcagatgcaagcgttccattcccct
aaagcactctttcctgttggttatgaagccagccgcttgtactggagcacccgctacgcc
aacaggcgctgccgttacctgtgctccattgaggagaaagatgggcgcccagtgttcgtg
atcagaattgtagagcaaggccatgaagatcttgtcttaagtgattcctctcctaaaggc
gtttgggataaaattttggagcccgtggcatgtgtgaggaaacagtctgaaatgctccag
ctttttccggcctatctaaagggagaagatctgtttgggctaacagtgtctgcagtggca
cggatcgcggagtcactccctggggttgaggcctgtgagaactacacctttcggtatggc
cgcaaccctctcatggaactccctcttgccgttaaccccacaggctgtgcccgttctgaa
cctaaaatgagtgcccatgtcaagaggcctcacaccctgaacagcaccagcacatccaag
tcctttcagagcacagtcacgggggagctgaacgcaccatacagtaagcagtttgtccac
tccaagtcctcgcagtaccggaagatgaagaccgagtggaaatccaatgtctatctggcc
cggtctcgtatccaggggctgggtctatatgctgctagagacatcgaaaagcacaccatg
gtcattgagtacatcgggactatcattcgaaacgaagttgcaaacagaaaagagaagctg
tatgagtctcagaatcgtggcgtgtacatgttccgcatggataatgaccatgtgattgat
gcaacactcaccggagggcctgccagatatatcaaccattcgtgtgcacctaactgtgtg
gctgaagtggtgacttttgagagaggacacaaaattatcatcagctccaaccggaggatc
cagaaaggagaagagctctgctacgattacaagttcgactttgaggatgaccagcacaag
atcccgtgtcactgcggagctgtgaactgccggaagtggatgaactga

DBGET integrated database retrieval system