KEGG   Canis familiaris (dog): 611216Help
Entry
611216            CDS       T01007                                 

Gene name
CDKN2D
Definition
cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4)
Orthology
K06623  
cyclin-dependent kinase inhibitor 2D
Organism
cfa  Canis familiaris (dog)
Pathway
FoxO signaling pathway
Cell cycle
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    611216 (CDKN2D)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    611216 (CDKN2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
20
AA seq 166 aa AA seqDB search
MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSPTIALEL
LKQGASPNVQDATGTTPAHDAARTGFLDTLKVLVEHGADVNAPDGTGALPIHLAVREGHT
AVVSFLATESDLHHRDARGLTPLELAQGIGAQDLMDILQGHTVVLL
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgctgctggaggaggtccgcgccggcgaccggctgagcggggccgcggcccgaggcgac
gtgcaggaggtgcgccgccttctgcaccgcgagctggtgcaccccgacgccctgaaccgc
ttcggcaagacggcgctgcaggtcatgatgtttggcagccccaccattgccttggagctc
ctcaagcaaggtgccagccccaatgtccaggatgccaccggcactactccagcccatgat
gcagcacgcactggattcctggacactctgaaagttttggtagagcatggtgctgatgtc
aatgctcccgatggcactggggcactccccatccatctggcagtgcgagagggccacaca
gctgtggtcagcttcctggctactgagtctgatctccatcacagggatgccagggggctc
acacccctggagctggcacaggggataggagctcaggatctcatggacatactgcagggg
cacactgtggtactgctgtga

DBGET integrated database retrieval system