KEGG   Canis familiaris (dog): 611349Help
Entry
611349            CDS       T01007                                 

Gene name
GNG13
Definition
(RefSeq) G protein subunit gamma 13
  KO
K04547  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04014  Ras signaling pathway
cfa04062  Chemokine signaling pathway
cfa04151  PI3K-Akt signaling pathway
cfa04371  Apelin signaling pathway
cfa04713  Circadian entrainment
cfa04723  Retrograde endocannabinoid signaling
cfa04724  Glutamatergic synapse
cfa04725  Cholinergic synapse
cfa04726  Serotonergic synapse
cfa04727  GABAergic synapse
cfa04728  Dopaminergic synapse
cfa04740  Olfactory transduction
cfa04742  Taste transduction
cfa04926  Relaxin signaling pathway
cfa05032  Morphine addiction
cfa05034  Alcoholism
cfa05167  Kaposi's sarcoma-associated herpesvirus infection
cfa05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    611349 (GNG13)
   04371 Apelin signaling pathway
    611349 (GNG13)
   04151 PI3K-Akt signaling pathway
    611349 (GNG13)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    611349 (GNG13)
  Endocrine system
   04926 Relaxin signaling pathway
    611349 (GNG13)
  Nervous system
   04724 Glutamatergic synapse
    611349 (GNG13)
   04727 GABAergic synapse
    611349 (GNG13)
   04725 Cholinergic synapse
    611349 (GNG13)
   04728 Dopaminergic synapse
    611349 (GNG13)
   04726 Serotonergic synapse
    611349 (GNG13)
   04723 Retrograde endocannabinoid signaling
    611349 (GNG13)
  Sensory system
   04740 Olfactory transduction
    611349 (GNG13)
   04742 Taste transduction
    611349 (GNG13)
  Environmental adaptation
   04713 Circadian entrainment
    611349 (GNG13)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    611349 (GNG13)
  Substance dependence
   05032 Morphine addiction
    611349 (GNG13)
   05034 Alcoholism
    611349 (GNG13)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    611349 (GNG13)
GTP-binding proteins [BR:cfa04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    611349 (GNG13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-gamma
Motif
Other DBs
NCBI-GeneID: 611349
NCBI-ProteinID: XP_005621792
Ensembl: ENSCAFG00000019608
UniProt: E2R7K4
Position
6
AA seq 67 aa AA seqDB search
MEEWDVPQMKKEVESLKYQLAFKREMSSKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVE
KGKCAIL
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
atggaggagtgggacgtgccccagatgaaaaaagaggtggagagcctcaaataccagctg
gccttcaagagggagatgtcgtcgaagaccatccctgagcttctcaagtggatagaggat
gggatccccaaggacccgttcctgaaccccgacctgatgaagaacaacccatgggtagag
aagggcaagtgcgccatcctgtga

DBGET integrated database retrieval system