KEGG   Canis familiaris (dog): 611349Help
Entry
611349            CDS       T01007                                 

Gene name
GNG13
Definition
guanine nucleotide binding protein (G protein), gamma 13
Orthology
K04547  
guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13
Organism
cfa  Canis familiaris (dog)
Pathway
Ras signaling pathway
Chemokine signaling pathway
PI3K-Akt signaling pathway
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Taste transduction
Morphine addiction
Alcoholism
Pathways in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    611349 (GNG13)
   04151 PI3K-Akt signaling pathway
    611349 (GNG13)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    611349 (GNG13)
  Nervous system
   04724 Glutamatergic synapse
    611349 (GNG13)
   04727 GABAergic synapse
    611349 (GNG13)
   04725 Cholinergic synapse
    611349 (GNG13)
   04728 Dopaminergic synapse
    611349 (GNG13)
   04726 Serotonergic synapse
    611349 (GNG13)
   04723 Retrograde endocannabinoid signaling
    611349 (GNG13)
  Sensory system
   04742 Taste transduction
    611349 (GNG13)
  Environmental adaptation
   04713 Circadian entrainment
    611349 (GNG13)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    611349 (GNG13)
  Substance dependence
   05032 Morphine addiction
    611349 (GNG13)
   05034 Alcoholism
    611349 (GNG13)
GTP-binding proteins [BR:cfa04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    611349 (GNG13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 67 aa AA seqDB search
MEEWDVPQMKKEVESLKYQLAFKREMSSKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVE
KGKCAIL
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
atggaggagtgggacgtgccccagatgaaaaaagaggtggagagcctcaaataccagctg
gccttcaagagggagatgtcgtcgaagaccatccctgagcttctcaagtggatagaggat
gggatccccaaggacccgttcctgaaccccgacctgatgaagaacaacccatgggtagag
aagggcaagtgcgccatcctgtga

DBGET integrated database retrieval system