KEGG   Canis familiaris (dog): 611498Help
Entry
611498            CDS       T01007                                 

Gene name
CACNG8
Definition
calcium channel, voltage-dependent, gamma subunit 8
Orthology
K04873  
voltage-dependent calcium channel gamma-8
Organism
cfa  Canis familiaris (dog)
Pathway
MAPK signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Oxytocin signaling pathway
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:cfa04010]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:cfa04921]
Organismal Systems; Circulatory system; Cardiac muscle contraction [PATH:cfa04260]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:cfa04261]
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:cfa05410]
Human Diseases; Cardiovascular diseases; Arrhythmogenic right ventricular cardiomyopathy (ARVC) [PATH:cfa05412]
Human Diseases; Cardiovascular diseases; Dilated cardiomyopathy (DCM) [PATH:cfa05414]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 497 aa AA seqDB search
PPPGPRLLLLLLLAAPRPARQAPGPTSACAVPPPAAGTAPPPLPRWWPAAPRLPVVKLES
LKRWNEERGLWCEKGVQVLLTTVGAFAAFGLMTIAISTDYWLYTRAFICNTTNLTASDDA
PPHRGGSGSSEKKDPGGLTHSGLWRICCLEGLKRGVCVKINHFPEDTDYDHDSAEYLLRV
VRASSIFPILSAILLLLGGVCVAASRVYKSKRNIILGAGILFVAAGLSNIIGVIVYISAN
AGEPGPKRDEEKKNHYSYGWSFYFGGLSFILAEVIGVLAVNIYIERSREAHCQSRSDLLK
AGGGAGGSGGSGPSAILRLPSYRFRYRRRSRSSSRSSEPSPSRDASPGGAGGPGFASTDI
SMYTLSRDPSKGSVAAGLAGAGGGGGGGGGGGGGGAAAYGGAGAGAGAGAGAGAGAGAGA
GGGGAGAERDRGGAPGFLTLHNAFPKEAGGGVTVTVTGPPAAPAPAPPAPAAPAPGTLAK
EAAASNTNTLNRKTTPV
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
cccccgcccgggccgcgcctcctcctcctcctcctcctcgccgccccccgcccagcccgg
caggccccgggccccacttctgcctgcgctgtgccccccccagccgccggcacggccccg
cccccgctgccccggtggtggcccgcggccccccggctgcccgtggtcaagctggagtcg
ctgaaacgctggaacgaagagcgaggcctctggtgcgagaagggggtgcaggtgctgctg
accacggtgggcgccttcgcggccttcggcctcatgaccatcgccatcagcaccgactac
tggctgtacacgcgcgccttcatctgcaacaccaccaacctcaccgccagcgacgacgcg
ccgccccaccgcgggggcagcggctcctcggagaagaaggacccgggcggcctcacgcac
tcggggctctggaggatctgctgcctggaagggttgaaaagaggcgtctgcgtgaagatc
aaccatttcccggaggacacggactatgaccatgacagcgcggagtatctgctccgagtg
gtccgggcctccagcatcttccccatcctcagcgccatcctgctgctgctcgggggtgtg
tgcgtggccgcctcccgggtctataagtccaaaaggaacatcattctgggagcagggatc
ctgttcgtggcagcaggcctgagcaacatcatcggcgtgatcgtgtacatctcggccaac
gcgggcgagccgggcccgaagcgggacgaggagaagaagaaccactactcgtacggctgg
tccttctacttcggcgggctgtcgttcatcctggccgaggtgatcggcgtgctggccgtc
aacatctacatcgagcgcagccgcgaggcgcactgccagtctcgctcggacctgctcaag
gccggcgggggcgcgggcggcagtggcgggagcggcccctcggccatcctccgtctgccc
agttaccgcttccgctaccgccgccgctcccgctctagctcccgctccagcgagccgtcg
ccgtcgcgggacgcatctcccggcggcgccgggggcccgggcttcgcctccacggacatc
tccatgtacacgctcagccgcgacccgtccaagggcagcgtggctgcggggctggcgggg
gccggcggcggcggcggcggcggcggcggcggcggcggcggcggggcggcggcgtacggg
ggcgcgggcgcgggcgcgggcgcgggcgcgggcgcgggcgcgggcgcgggcgcgggcgcg
ggcggcggcggggcgggcgccgagcgggaccgcgggggggcgcccggcttcctcacgctg
cacaacgccttccccaaggaggcgggcggcggcgtcacggtcacggtcaccgggccgccc
gccgcgcccgcgcccgccccgcccgcgcccgccgcgccggcccccgggaccctggccaag
gaggccgccgcctccaacaccaacacgctcaacaggaaaaccacgccggtgtag

DBGET integrated database retrieval system