KEGG   Canis familiaris (dog): 611649Help
Entry
611649            CDS       T01007                                 

Gene name
CYLD
Definition
cylindromatosis (turban tumor syndrome)
Orthology
K08601  
ubiquitin thioesterase CYLD [EC:3.1.2.15]
Organism
cfa  Canis familiaris (dog)
Pathway
Osteoclast differentiation
RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    611649 (CYLD)
  Development
   04380 Osteoclast differentiation
    611649 (CYLD)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     611649 (CYLD)
Peptidases [BR:cfa01002]
 Cysteine Peptidases
  Family C67
   611649 (CYLD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 956 aa AA seqDB search
MSSGLWSQEKVTSPYWEERIFYLLLQECSVTDKQTQKLLKVPKGSIGQYIQDRSVGHSRI
PSAKGKKNQIGLKILEQPHAVLFVDEKDVVEINEKFTELLLAITNCEERFSLFKNKNRLS
KGLQIDVGCPVKVQLRSGEEKFPGVVRFRGPLLAERTVSGIFFGVELLEEGRGQGFTDGI
YQGKQLFQCDEDCGVFVALDKLEILEDDDNGLESDYAGPGDTMQMELPPLEINSRVSLKL
GETIESGTVIFCDVLPGKESLGYFVGVDMDNPIGNWDGRFDGVQLCSFASVESTILLHIN
DIIPALSDSVTQERRPPKLAFMSRGVGDKGSSSHNKPKATGSTSDPGNRNRSELFYTLNG
SSVDSQPQSKSKNTWYIDEVAEDPAKSLTEISPDFGHASPPLQPPSMNSLSTENRFHSLP
FSLTKMPNTNGSIGHSPLSLSVQSVMGELNNAPVQESPPLAMTSGNSHGLEVGSLAEVKE
NPPFYGVIRWIGQPPGLNEVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCR
PDSRFASLQPVSNQIERCNSLAFGGYLSEVVEENTPPKMEKEGLEIMIGKKKGIQGHYNS
CYLDSTLFCLFAFSSVLDTVLLRPKEKNDVGYYSETQELLRTEIVNPLRIYGYVCATKIM
KLRKILEKVEAASGFTSEEKDPEEFLNILFHQILRVEPLLKIRSAGQKVQDCYFYQIFME
KNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDL
LEDTPRQCRICGGLAMYECRECYDDPDISAGNIKQFCKTCNTQVHLHPKRLNHKYNPVSL
PKDLPDWDWRHGCIPCQKMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNG
FNIPQVTPCPEVGEYLKMSPEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atgagttcaggcttatggagccaagaaaaagttacttcaccctactgggaagagcggatt
ttttatttgcttcttcaagaatgcagtgttacagacaaacaaacacaaaagctccttaaa
gtaccaaaggggagtataggacagtatatccaagatcgttctgtgggtcactcgaggatt
ccttctgcaaaaggcaagaaaaatcagattggattaaaaattttagagcaaccacatgca
gttctctttgttgatgaaaaggatgttgtagaaataaatgaaaaattcacagaattgctt
ttggcaattaccaattgtgaagagaggttcagcctgtttaagaacaaaaacagactaagt
aaaggcctccagatagatgtgggctgccctgtgaaagtacagctgagatctggggaagaa
aaatttccaggagttgtgcgcttcagaggacccttattagcagagaggacagtgtcggga
atattctttggagtagaattactggaagaaggtcgcggccaaggtttcactgatgggata
tatcaagggaaacaactttttcagtgcgatgaagactgtggagtatttgttgcgttggac
aagctagaaatcctagaagatgatgacaatggattggaaagtgattatgcaggtccaggg
gacacaatgcagatggaacttccccctctggaaataaactccagagtttctttgaagctt
ggagaaactatagagtctggcacagtcatattctgtgatgtcttgccaggaaaagaaagc
ttaggatattttgttggtgtggacatggataatcctattggcaattgggatggcagattt
gatggagtgcagctgtgtagttttgcaagtgttgaaagtacaattcttttgcacatcaat
gatatcatcccagctttatcagatagcgtgacacaggaaaggaggcctcccaaacttgcc
tttatgtcaagaggtgttggggacaaaggttcctccagtcataataaaccaaaggccaca
ggatctacctcagaccctggaaatagaaacagatctgaattattttatactttaaatgga
tcttctgttgactcacaaccacaatccaaatcaaaaaacacatggtacattgatgaagtt
gctgaagaccctgcaaaatcgcttacagagatatctccagactttggacacgcttcacca
ccactgcaacctccttctatgaactcattatccaccgaaaacagatttcactctttaccg
ttcagtttgacaaagatgcccaataccaatggaagtattggccacagtccactctctctg
tcagttcagtccgtgatgggagagctaaacaatgcacctgtccaggagagtccccccttg
gccatgacttctgggaactcacatggtctggaagtgggctctctggctgaagttaaagag
aatccccctttctatggggtaatccgttggattggtcagccaccaggactcaatgaagtg
ctagctggactggaactggaagatgagtgtgcaggctgtacagatggaaccttcaggggc
acccggtacttcacctgtgccctgaagaaggcactgtttgttaaactgaagagctgcagg
ccagactccaggtttgcgtctctgcagccggtttccaatcagatcgagcgctgcaactct
ctagcatttggcggctacttgagtgaagtagtggaagaaaataccccacccaaaatggaa
aaagaaggtttagagataatgattggaaagaagaagggtatccaggggcattacaattct
tgttacttagactcaaccttattctgcttgtttgcttttagttctgttctggacactgtg
ttacttagacctaaagaaaagaatgatgtaggatattatagtgaaactcaggagctactg
aggacagaaattgttaatcctctgcgaatatatggatatgtgtgtgcaacaaagattatg
aaactgaggaaaatacttgaaaaagttgaggctgcatcaggatttacctctgaagaaaaa
gatcctgaagaattcttgaatatcctatttcatcaaattttaagggtagaaccattgttg
aaaataagatcagcaggtcaaaaagtacaagattgttacttctatcaaatttttatggaa
aaaaatgagaaagttggagttcctacaattcagcagttattagaatggtcttttatcaac
agtaacctgaaatttgcagaggcaccatcgtgcctgattattcagatgcctcgatttgga
aaagactttaaactgtttaaaaaaatttttccttctttggagttaaatataacagattta
cttgaagacacccccaggcagtgccggatatgcggggggcttgccatgtatgaatgtaga
gaatgttatgatgaccctgacatctccgctggaaacatcaagcagttttgtaaaacctgc
aacactcaagtccaccttcatcccaagagactgaaccataaatataacccggtgtcactt
cccaaagatttacctgactgggactggaggcatggctgcatcccctgccagaagatggaa
ttatttgctgttctctgcatagaaacaagccactatgttgcttttgtgaagtatgggaag
gacgactctgcctggctcttctttgacagcatggctgatcgggatggcggccaaaatggc
ttcaacattcctcaagttaccccatgcccagaagtaggagagtacttgaaaatgtctcca
gaggacctgcattccttggactccagaagaatccaaggctgcgcacgaagacttctttgt
gatgcctacatgtgcatgtaccagagtccgacaatgagtttgtacaaataa

DBGET integrated database retrieval system