KEGG   Canis familiaris (dog): 611845Help
Entry
611845            CDS       T01007                                 

Gene name
JOSD2
Definition
Josephin domain containing 2
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
cfa  Canis familiaris (dog)
Brite
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     611845 (JOSD2)
Peptidases [BR:cfa01002]
 Cysteine Peptidases
  Family C86
   611845 (JOSD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 188 aa AA seqDB search
MSQAPGAQPSRPSVYHERQRLELCAVHALNNVLQQQLFSQEAADEICKRLAPDSRLNPHR
SLLGTGNYDVNVIMAALQGLGLATVWWDRRRPLSQLALSQVLGLILNLPSPMSLGLLSLP
LRRRHWVALRQVDGVYYNLDSKLRAPEALGDEDGVRAFLAAALAQGLCEVLLVVTKEVEE
KGCWLRTV
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaggccccaggagcacagccgagccggccctccgtttatcacgaacggcaacgc
ctggagctgtgtgccgtccacgcccttaacaacgtcctgcagcagcagctctttagccag
gaggctgccgatgagatctgcaagaggttggccccagactcccggctgaatccccatcgc
agcctcctcggcaccggcaactatgatgtcaacgtgatcatggcagccctgcaggggctg
ggcctggccaccgtgtggtgggacagaaggaggcccctgtcccagctggccctgtcccag
gtactgggactgatcctgaacctgccctcacccatgtccctggggctgctgtccctgcca
ctgcgccggcggcactgggtggccctccgccaggtggatggcgtctactacaacctggac
tccaagctgcgggcgcccgaggccctaggggacgaggatggtgtcagggccttcctggca
gctgccctggcccagggcctgtgtgaggtgctgctggtggtgaccaaggaggtggaagag
aagggctgctggctgcggacggtctga

DBGET integrated database retrieval system