KEGG   Canis familiaris (dog): 611847Help
Entry
611847            CDS       T01007                                 

Gene name
POLD4
Definition
polymerase (DNA-directed), delta 4, accessory subunit
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
cfa  Canis familiaris (dog)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
HTLV-I infection
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    611847 (POLD4)
   00240 Pyrimidine metabolism
    611847 (POLD4)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    611847 (POLD4)
   03410 Base excision repair
    611847 (POLD4)
   03420 Nucleotide excision repair
    611847 (POLD4)
   03430 Mismatch repair
    611847 (POLD4)
   03440 Homologous recombination
    611847 (POLD4)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    611847 (POLD4)
DNA repair and recombination proteins [BR:cfa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      611847 (POLD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
18
AA seq 180 aa AA seqDB search
MGRKRLITDSYPVVKRGEGPAGHSKGELAPELGLFRVRGAGALDTSEGLARTRADGGAAR
GSETCPLLPTAGLAVAGRGKGLVRAGEQWGSCEAGGRPEEPRVIAGEEPQPLSVDEAELE
LLRQFDLAWQYGPCTGITRLQRWHRAEQMGLEPPPEVRQVLQTHPGDPRFQCSLWHLYPL
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgggccggaagcggctcatcactgactcctaccccgtagtgaagaggggggagggcccc
gctgggcacagcaagggggagctggcaccggagctaggtctcttccgcgtgcggggggcg
ggagcactggacaccagcgaggggcttgcgaggacgcgggcggacgggggtgctgcgagg
ggaagtgaaacatgtcctctacttcctactgcaggcctggcagtggccggcagaggcaaa
gggctggtgagggccggggagcagtggggcagctgcgaggccgggggcaggcctgaggag
ccgcgtgtcattgcaggggaagagccccagcccctgagcgtggatgaagcagagctggag
ctgctgaggcagtttgatctcgcctggcagtatgggccctgcacagggatcacacggttg
cagcgctggcatcgggcggagcagatgggcttggagcctcccccagaagtgcgtcaggtg
ctacagacccaccctggagatccccgcttccagtgcagcctctggcatctctatcccctg
tga

DBGET integrated database retrieval system