KEGG   Canis familiaris (dog): 611993Help
Entry
611993            CDS       T01007                                 

Gene name
GYS1
Definition
(RefSeq) glycogen synthase 1
  KO
K00693  
glycogen synthase [EC:2.4.1.11]
Organism
cfa  Canis familiaris (dog)
Pathway
Starch and sucrose metabolism
Metabolic pathways
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Glucagon signaling pathway
Insulin resistance
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    611993 (GYS1)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    611993 (GYS1)
   04152 AMPK signaling pathway
    611993 (GYS1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    611993 (GYS1)
   04922 Glucagon signaling pathway
    611993 (GYS1)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    611993 (GYS1)
Enzymes [BR:cfa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     611993 (GYS1)
Glycosyltransferases [BR:cfa01003]
 Polysaccharide
  Storage polysaccharide
   611993 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 737 aa AA seqDB search
MPLSRTLSMSSLPGLEDWEDEFDLENTVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEPPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQNEEKPHVVAHFH
EWLAGIGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFKGDKEAGERQIYH
RYCMEGAAAHGAQVCTTGXQITPFEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALAKAFPEHFTYEPHEADATQGYRYPRPASVPPSPSLSRHSSPHQSEDE
EEPRDGPPDVDGERYDEDEEAAKDRRNIRAPEWPRRASCTSSTGGSKRSSVDTAPSSSLS
TPSEPLSPASSLGEERN
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgcctctaagccgcactttgtccatgtcctcactgccaggactggaggattgggaggat
gaattcgatctggagaacacagtgctcttcgaggtggcctgggaagtggccaacaaggtg
ggtggcatctacaccgtgctgcagacgaaggcgaaggtgacaggggatgagtggggcgac
aactactacctggttggaccgtacacagagcagggcgtgaggacccaggtggaactgctc
gagcccccaaccccagctctgaagaggacactggactccatgaacagcaaaggctgcaag
gtgtatttcggtcgctggctgatcgaggggggccccctggtggtgctcctggatgtgggg
gcctcagcctgggccctggagcgctggaagggggagctctgggacacctgcaacatcggg
gtgccctggtacgaccgtgaggccaacgatgctgtcctttttggcttcctcaccacctgg
ttcctgggtgagttcctggcccagaacgaggagaagccacatgtggttgcacacttccat
gagtggttggcaggcattggactctgcttgtgccgggcccggcggcttcctgtggctaca
atcttcaccacccacgccacgctcctgggacgatacctgtgtgcgggtgccgtagacttc
tacaacaacctggagaatttcaagggggacaaggaagcaggtgagaggcaaatctatcac
cgttactgcatggagggggcagcggcccacggcgctcaggtatgtactacaggtnaacag
atcacgccatttgaggcccagcacctactcaagaggaaaccagatatcgtgacccccaat
gggctgaatgtgaagaagttctccgccatgcatgagttccagaacctccatgctcagagc
aaggctcgaatccaggagtttgtgcggggccatttttatggacacctggacttcaacttg
gacaagaccttgtatttctttatcgctggccgctacgagttctctaacaagggggccgat
gtcttcctagaggccttggcccggctcaattatctgctcagagtgaacggcagcgagcag
acggtggttgccttcttcatcatgccagcccggaccaacaacttcaacgtggaaaccctc
aagggccaagctgtgcgcaagcagctttgggatacagccaacacagtgaaagagaagttc
ggaaggaagctttacgaatccttgctggtggggagcctcccggacatgaacaagatgctg
gacaaggaggacttcactatgatgaagagagccatctttgccacgcagcgacagtctttc
ccccctgtgtgcacccacaacatgctggacgactcctcggaccctatcctgaccaccatc
cgccgaattgggctcttcaatagtagtgctgacagggtcaaggttattttccatccagag
tttctctcctccacgagccccctgctccccgtggattatgaagaatttgtccgtggctgc
caccttggggtctttccctcctactatgaaccttggggctacacgccggctgagtgcacg
gttatgggcatccccagtatctccaccaacctctctggcttcggctgcttcatggaggaa
cacattgcagacccctccgcttacggcatctacatcctggaccggcggttccgcagtctg
gatgattcctgctcccagctcacctccttcctctacagcttctgccagcagagccggcgg
cagcgcatcatccagcgaaaccgcaccgagcgcctctcagaccttctggactggaaatac
ctaggccggtactatatgtctgcacgccacatggcgctggccaaggcctttccagaacac
ttcacctatgagccccacgaggctgacgcgactcagggctaccgctacccgcggccggcc
tcggtgccaccatcgccctcgctgtcgcgccactcaagtccgcaccagagtgaggacgag
gaggagccgcgggacgggccgccggatgtagatggggagcgctacgacgaggacgaggag
gcagccaaggaccggcgcaacatccgcgccccggagtggccgcgccgcgcctcctgcacc
tcttccaccggcgggagcaagcgcagctcggtggacacggcgccctccagctcgctcagc
actcccagtgagcccctcagccctgccagctccctgggcgaggagcgcaactga

DBGET integrated database retrieval system