KEGG   Canis familiaris (dog): 612022Help
Entry
612022            CDS       T01007                                 

Gene name
ST3GAL5
Definition
(RefSeq) ST3 beta-galactoside alpha-2,3-sialyltransferase 5
  KO
K03370  
lactosylceramide alpha-2,3-sialyltransferase (sialyltransferase 9) [EC:2.4.99.9]
Organism
cfa  Canis familiaris (dog)
Pathway
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Module
Glycosphingolipid biosynthesis, ganglio series, LacCer => GT3
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    612022 (ST3GAL5)
Enzymes [BR:cfa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.9  lactosylceramide alpha-2,3-sialyltransferase
     612022 (ST3GAL5)
Glycosyltransferases [BR:cfa01003]
 Terminal extension
  Sialyltransferase
   612022 (ST3GAL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
17
AA seq 421 aa AA seqDB search
MRTKAAGGAERRPLQLRTEAAAAAAAPAGRAMPSEYNYVKLRSDRSRPSLQWYTRAQNKM
RRPNLLLKDILKCTLLVFGVWILYILKLNYTTEECDMKKMHYVDPDRVKRAQKYAQQVLQ
KECRPKFAKKSMAQLFEHRYSTDLPPFVKETPKMNEAEYKYDPPFGFRKFSSEVQTLLEI
LPEHDMPEHLRAKSCRRCVVIGSGGILHGLALGQALNQFDVVIRLNSAPVEGYSEHVGNK
TTIRMTYPEGAPLSDLEYYSNDLFVAVLFKSVDFNWLQAMVKNETLPFWVRLFFWKQVAE
KIPLQPKHFRILNPVIIKETAFDILQYSEPQSRFWGRDKNVPTIGVIAVVLATHLCDEVS
LAGFGYDLNQPKTPLHYFDNLCMAAMNFQTMHNVTTETRFLLKLVKEGVVKDLSGGIHCE
F
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgcggacgaaggctgcgggcggcgcggagcggcgtcccttgcagctgcgaaccgaggcg
gcggcggcggcggcggcacctgccggccgagcaatgcccagtgagtataactatgtaaaa
ctgagaagcgatcgctcaagaccctctctgcaatggtacacccgagctcaaaacaagatg
agaagacccaacttgttgttaaaagacatccttaagtgtacattgcttgtgtttggagtg
tggatcctttatattctcaagttaaattatactactgaagaatgtgacatgaaaaaaatg
cattatgtggacccagaccgtgtaaagagagctcagaaatatgctcagcaagtcttgcaa
aaggagtgccgacccaagtttgcgaagaagtcgatggcgcagttgttcgagcacaggtac
agcacggacttgccacctttcgtgaaggagacccccaaaatgaatgaagccgagtacaag
tatgatcctccttttggattccgaaagttctccagtgaagtccagaccctgttggaaata
ctgcccgagcatgacatgcccgaacacttgagagcaaagagctgtaggcgttgtgtggtc
atcggaagcggtggcatactccacggactagcactgggccaggccctcaaccagttcgat
gtggtgataaggttaaacagtgcaccagttgagggatattctgagcatgttggtaataaa
actactataaggatgacttatccagagggcgcgccactgtctgaccttgaatattattcc
aatgacttgtttgttgctgttttattcaagagtgttgacttcaactggcttcaagcaatg
gtaaaaaatgaaaccctgccattttgggtgcggctcttcttttggaagcaggtggcggaa
aaaatcccactacagccaaaacatttcaggattttgaatccagttattatcaaagagact
gcctttgacatccttcaatactcagagccccagtcaaggttctggggccgagataagaac
gtgcccaccattggtgtcattgccgttgtcttagccacacatctgtgtgatgaagtcagc
ttggcaggctttggatatgacctcaatcaacccaaaacacctttgcactactttgacaat
ctctgcatggctgccatgaactttcaaaccatgcataatgtgacaacggagaccaggttc
ctcctcaagctggtcaaagagggcgtggtgaaggatctcagcggaggcatccattgtgaa
ttttga

DBGET integrated database retrieval system