KEGG   Canis familiaris (dog): 612022Help
Entry
612022            CDS       T01007                                 

Gene name
ST3GAL5
Definition
ST3 beta-galactoside alpha-2,3-sialyltransferase 5
Orthology
K03370  
lactosylceramide alpha-2,3-sialyltransferase (sialyltransferase 9) [EC:2.4.99.9]
Organism
cfa  Canis familiaris (dog)
Pathway
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Module
Glycosphingolipid biosynthesis, ganglio series, LacCer => GT3
Class
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:cfa00604]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
17
AA seq 390 aa AA seqDB search
MPSEYNYVKLRSDRSRPSLQWYTRAQNKMRRPNLLLKDILKCTLLVFGVWILYILKLNYT
TEECDMKKMHYVDPDRVKRAQKYAQQVLQKECRPKFAKKSMAQLFEHRYSTDLPPFVKET
PKMNEAEYKYDPPFGFRKFSSEVQTLLEILPEHDMPEHLRAKSCRRCVVIGSGGILHGLA
LGQALNQFDVVIRLNSAPVEGYSEHVGNKTTIRMTYPEGAPLSDLEYYSNDLFVAVLFKS
VDFNWLQAMVKNETLPFWVRLFFWKQVAEKIPLQPKHFRILNPVIIKETAFDILQYSEPQ
SRFWGRDKNVPTIGVIAVVLATHLCDEVSLAGFGYDLNQPKTPLHYFDNLCMAAMNFQTM
HNVTTETRFLLKLVKEGVVKDLSGGIHCEF
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgcccagtgagtataactatgtaaaactgagaagcgatcgctcaagaccctctctgcaa
tggtacacccgagctcaaaacaagatgagaagacccaacttgttgttaaaagacatcctt
aagtgtacattgcttgtgtttggagtgtggatcctttatattctcaagttaaattatact
actgaagaatgtgacatgaaaaaaatgcattatgtggacccagaccgtgtaaagagagct
cagaaatatgctcagcaagtcttgcaaaaggagtgccgacccaagtttgcgaagaagtcg
atggcgcagttgttcgagcacaggtacagcacggacttgccacctttcgtgaaggagacc
cccaaaatgaatgaagccgagtacaagtatgatcctccttttggattccgaaagttctcc
agtgaagtccagaccctgttggaaatactgcccgagcatgacatgcccgaacacttgaga
gcaaagagctgtaggcgttgtgtggtcatcggaagcggtggcatactccacggactagca
ctgggccaggccctcaaccagttcgatgtggtgataaggttaaacagtgcaccagttgag
ggatattctgagcatgttggtaataaaactactataaggatgacttatccagagggcgcg
ccactgtctgaccttgaatattattccaatgacttgtttgttgctgttttattcaagagt
gttgacttcaactggcttcaagcaatggtaaaaaatgaaaccctgccattttgggtgcgg
ctcttcttttggaagcaggtggcggaaaaaatcccactacagccaaaacatttcaggatt
ttgaatccagttattatcaaagagactgcctttgacatccttcaatactcagagccccag
tcaaggttctggggccgagataagaacgtgcccaccattggtgtcattgccgttgtctta
gccacacatctgtgtgatgaagtcagcttggcaggctttggatatgacctcaatcaaccc
aaaacacctttgcactactttgacaatctctgcatggctgccatgaactttcaaaccatg
cataatgtgacaacggagaccaggttcctcctcaagctggtcaaagagggcgtggtgaag
gatctcagcggaggcatccattgtgaattttga

DBGET integrated database retrieval system