KEGG   Canis familiaris (dog): 612101Help
Entry
612101            CDS       T01007                                 

Gene name
RASGRP2
Definition
RAS guanyl releasing protein 2 (calcium and DAG-regulated)
Orthology
K12361  
RAS guanyl-releasing protein 2
Organism
cfa  Canis familiaris (dog)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Chemokine signaling pathway
Platelet activation
Pathways in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    612101 (RASGRP2)
   04015 Rap1 signaling pathway
    612101 (RASGRP2)
   04010 MAPK signaling pathway
    612101 (RASGRP2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    612101 (RASGRP2)
   04062 Chemokine signaling pathway
    612101 (RASGRP2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    612101 (RASGRP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
18
AA seq 607 aa AA seqDB search
MAGALDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIY
QQSRKDNSNSLQVKTCHLVSRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLI
DIESVPTYKWKRQVTQRNPVAQKKRKMSLLFDHLEPLELAEHLTYLEYRSFCKILFQDYH
SFVTHGCTVDNPVLERFISLFNSVSQWVQLMILSKPTAPQRALVITHFVHVAEKLLHLQN
FNTLMAVVGGLSHSSISRLKETHSHVSSETIKLWEGLTELVTATSNYGNYRRRLAACVGF
RFPILGVHLKDLVALQLALPDWLDPARTRLNGAKMKQLFSILEELAMVTSLRPPVQANPD
LLSLLTVSLDQYQTEDELYQLSLQREPRSKSSPTSPTSCTPPPRPPVLDEWTSAAKPKLD
QALLVEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREE
MVSYFLRSSSVLGGRMGFVHNFHESSSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQ
CKDRLSVECRRRAQSVSLEGSAPSPSPTHHRAFSFSLPRPGRRGSRPPEIREEEVQAVED
GVFDIHL
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgctctggacctggacaagggctgcaccgtggaggagctgctccgcggctgc
atcgaagccttcgatgactccgggaaggtgcgggacccgcagctggtgcgcatgtttctc
atgatgcacccttggtacatcccttcctctcagctggcggcaaagctgctccacatctat
caacaatcccggaaggataactccaattcgctgcaggtgaaaacgtgccacctggtcagc
aggtactggatctcagcattcccagcagagtttgacttgaaccctgagctcgctgagcag
atcaaggagctgaaggctctgctagaccaagaagggaaccggcgccacagcagcctcatt
gacatcgagagcgtccccacctacaagtggaagcggcaggtgacccagcggaaccctgta
gcacagaaaaaacgaaagatgtccctattgttcgaccacctggaacccttggaactagca
gagcatctcacctacttagagtatcgctccttctgcaagatcctgtttcaggactatcac
agttttgtgactcatggctgcaccgtggacaaccccgtcctggagagattcatctccctc
ttcaacagtgtctcacagtgggtgcagcttatgattctcagcaagcccactgcccctcag
cgtgccctggtcatcacgcactttgtccacgtggcagagaagctgcttcacttgcagaac
ttcaacactctgatggccgtggtcggaggcctgagccacagctccatctcccgcctcaag
gagactcacagtcatgttagctctgagaccattaagctctgggaaggtctgacagaacta
gtgacggccacgagcaactatggcaactaccggcgccggctggcagcctgtgtgggtttc
cgctttcctatcctgggtgtacacctcaaggacctggtggctctgcagctggcactgcct
gactggctggaccctgcccggacccgacttaatggggccaagatgaagcagctcttcagc
atcctggaggagctggccatggtgaccagccttcggccaccagtgcaggccaaccctgat
ctgctgagcctactcacggtatctctggatcagtatcagacagaggatgaactctaccag
ctgtccctgcagcgggagccacgctccaagtcctcgccaaccagccccacaagctgcacc
ccacctccccggcccccagttctggatgagtggacctcagctgccaaacccaagctggac
caggcactcctggtggaacacatcgagaagatggtggagtctgtgttccggaactttgac
gtcgatggggatggccacatctcacaggaagagttccagatcatccgtgggaacttccct
tacctcagcgcctttggggacctcgaccagaaccaggatggctgcatcagcagggaggag
atggtctcttacttcctgcgctccagctcggtgctgggcggccgcatgggcttcgtgcac
aacttccacgagagcagctccctgcgcccggttgcctgccgccactgcaaggccctgatc
ctgggcatctacaagcagggcctcaaatgccgagcctgcggtgtgaactgccacaaacag
tgtaaagaccgtctgtcggttgaatgccggcgccgggcacagagtgtgagtctggagggg
tctgcaccctcaccctcacccacccatcaccgggccttcagcttctccctgccccgccca
ggtaggcgaggctcccggcctccagagatccgagaagaggaggtgcaagcagtggaggac
ggtgtattcgacatccacttgtaa

DBGET integrated database retrieval system