KEGG   Canis familiaris (dog): 612101Help
Entry
612101            CDS       T01007                                 

Gene name
RASGRP2
Definition
RAS guanyl releasing protein 2 (calcium and DAG-regulated)
Orthology
K12361  
RAS guanyl-releasing protein 2
Organism
cfa  Canis familiaris (dog)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Chemokine signaling pathway
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:cfa04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:cfa04015]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:cfa04010]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:cfa04062]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
18
AA seq 607 aa AA seqDB search
MAGALDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIY
QQSRKDNSNSLQVKTCHLVSRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLI
DIESVPTYKWKRQVTQRNPVAQKKRKMSLLFDHLEPLELAEHLTYLEYRSFCKILFQDYH
SFVTHGCTVDNPVLERFISLFNSVSQWVQLMILSKPTAPQRALVITHFVHVAEKLLHLQN
FNTLMAVVGGLSHSSISRLKETHSHVSSETIKLWEGLTELVTATSNYGNYRRRLAACVGF
RFPILGVHLKDLVALQLALPDWLDPARTRLNGAKMKQLFSILEELAMVTSLRPPVQANPD
LLSLLTVSLDQYQTEDELYQLSLQREPRSKSSPTSPTSCTPPPRPPVLDEWTSAAKPKLD
QALLVEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREE
MVSYFLRSSSVLGGRMGFVHNFHESSSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQ
CKDRLSVECRRRAQSVSLEGSAPSPSPTHHRAFSFSLPRPGRRGSRPPEIREEEVQAVED
GVFDIHL
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgctctggacctggacaagggctgcaccgtggaggagctgctccgcggctgc
atcgaagccttcgatgactccgggaaggtgcgggacccgcagctggtgcgcatgtttctc
atgatgcacccttggtacatcccttcctctcagctggcggcaaagctgctccacatctat
caacaatcccggaaggataactccaattcgctgcaggtgaaaacgtgccacctggtcagc
aggtactggatctcagcattcccagcagagtttgacttgaaccctgagctcgctgagcag
atcaaggagctgaaggctctgctagaccaagaagggaaccggcgccacagcagcctcatt
gacatcgagagcgtccccacctacaagtggaagcggcaggtgacccagcggaaccctgta
gcacagaaaaaacgaaagatgtccctattgttcgaccacctggaacccttggaactagca
gagcatctcacctacttagagtatcgctccttctgcaagatcctgtttcaggactatcac
agttttgtgactcatggctgcaccgtggacaaccccgtcctggagagattcatctccctc
ttcaacagtgtctcacagtgggtgcagcttatgattctcagcaagcccactgcccctcag
cgtgccctggtcatcacgcactttgtccacgtggcagagaagctgcttcacttgcagaac
ttcaacactctgatggccgtggtcggaggcctgagccacagctccatctcccgcctcaag
gagactcacagtcatgttagctctgagaccattaagctctgggaaggtctgacagaacta
gtgacggccacgagcaactatggcaactaccggcgccggctggcagcctgtgtgggtttc
cgctttcctatcctgggtgtacacctcaaggacctggtggctctgcagctggcactgcct
gactggctggaccctgcccggacccgacttaatggggccaagatgaagcagctcttcagc
atcctggaggagctggccatggtgaccagccttcggccaccagtgcaggccaaccctgat
ctgctgagcctactcacggtatctctggatcagtatcagacagaggatgaactctaccag
ctgtccctgcagcgggagccacgctccaagtcctcgccaaccagccccacaagctgcacc
ccacctccccggcccccagttctggatgagtggacctcagctgccaaacccaagctggac
caggcactcctggtggaacacatcgagaagatggtggagtctgtgttccggaactttgac
gtcgatggggatggccacatctcacaggaagagttccagatcatccgtgggaacttccct
tacctcagcgcctttggggacctcgaccagaaccaggatggctgcatcagcagggaggag
atggtctcttacttcctgcgctccagctcggtgctgggcggccgcatgggcttcgtgcac
aacttccacgagagcagctccctgcgcccggttgcctgccgccactgcaaggccctgatc
ctgggcatctacaagcagggcctcaaatgccgagcctgcggtgtgaactgccacaaacag
tgtaaagaccgtctgtcggttgaatgccggcgccgggcacagagtgtgagtctggagggg
tctgcaccctcaccctcacccacccatcaccgggccttcagcttctccctgccccgccca
ggtaggcgaggctcccggcctccagagatccgagaagaggaggtgcaagcagtggaggac
ggtgtattcgacatccacttgtaa

DBGET integrated database retrieval system