KEGG   Canis familiaris (dog): 612206Help
Entry
612206            CDS       T01007                                 

Gene name
GBA
Definition
glucosidase, beta, acid
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
cfa  Canis familiaris (dog)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:cfa00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:cfa00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:cfa04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 487 aa AA seqDB search
MELSSPPREDRLQPLGRVSIMAASLMGLLLLQAVSCVSGARPCIPKSFGYSSVVCVCNAT
YCDSLDPLALPAPGTFSQYESTRSGRRMELSLGTIRANHTGTGIEYNIIRVPMASCDFSI
RTYTYDDTHDDFQLHNFSLPEEDIKLKIPLIHQALELAQHPVSLFASPWTSPTWLKTNGA
VNGKGSLKGQPGDLYHQTWARYFVKFLDAYAEHKLQFWAVTAENEPSAGLFSGYPFQCLG
FTPEHQRDFIARDLGPALANSTHHDIRLLILDDQRLLLPHWAQVVLADPEAAKYVHGIAV
HWYLDFLAPAKATLGETHRLFPNTMLFASEACVGSKFWEQSVRLGSWDRGVQYSHSIITN
LLYHVVGWTDWNLALNLEGGPNWVRNFVDSPIIVDITKDVFYKQPMFYHLGHFSKFIPEG
SQRVGLAASKKNGLDTVALTRPDGSAVVVVLNRSSKDVPLTIKDPAVGFVETLSPAYSIH
TYLWRRQ
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggagctttccagtcctcccagagaggaccgtctccagcccctgggcagggtaagcatc
atggctgccagcctcatgggattgcttctacttcaggcagtatcatgtgtatcaggtgcc
cgcccctgcatccctaaaagctttggctacagctcagtagtctgtgtctgcaatgccaca
tactgtgactctcttgaccccctggccctgcctgcccctggcaccttcagccagtatgag
agcacacgcagcgggcgccgaatggagctgagtctggggaccatccgggccaaccacacg
ggcacaggaatcgaatacaacatcatccgggtacccatggccagctgtgacttctccatc
cgcacctacacctatgatgacacccatgatgacttccagttgcataacttcagcctccct
gaggaagacatcaagctcaagatacccctgattcaccaagccctagaactggcccagcac
cctgtgtcactcttcgccagtccctggacatcacccacttggctgaagaccaacggggca
gtgaatgggaaggggtcactcaagggtcagcctggggatctctaccaccagacgtgggcc
agatactttgttaagttcctggacgcctatgcagagcacaagttgcagttctgggcagtg
acggcagagaatgagccttccgcagggcttttcagcggataccccttccagtgcttgggc
ttcacccctgaacaccagcgagacttcattgcccgggacctgggtcctgccctggccaac
agtacacaccatgacatccgtctgctcatactagatgaccagcgcttgctgctgccccac
tgggcccaggtggtactggcagacccagaggcagccaagtacgtccatggcattgctgta
cattggtacctggactttctggctccagcgaaagccacactgggggagacacaccgcctg
ttccccaacacaatgctctttgcctcagaggcctgtgtgggctccaagttctgggagcag
agtgtgcggctgggctcttgggaccgaggggtgcagtacagccacagcatcatcacgaac
ctcctctaccatgtggttggctggaccgactggaaccttgccctgaacctggaaggaggg
cccaactgggtgcgcaactttgtcgacagccccatcatcgtcgacatcaccaaagatgtg
ttctataaacagcccatgttctaccaccttggccacttcagcaagttcatcccagagggc
tcccagagagtggggctggcagccagcaagaagaatggcttggacactgtggcactgaca
cgtcctgacggctctgcagttgtggttgtgttaaaccggtcctcgaaggatgtgcctctc
accatcaaggaccctgccgtgggcttcgtggagacgctctctccagcctactccattcat
acgtatctgtggcgtcgccagtga

DBGET integrated database retrieval system