KEGG   Canis familiaris (dog): 612477Help
Entry
612477            CDS       T01007                                 

Definition
cytochrome P450 2F5-like
Orthology
K07416  
cytochrome P450, family 2, subfamily F [EC:1.14.14.1]
Organism
cfa  Canis familiaris (dog)
Pathway
Metabolism of xenobiotics by cytochrome P450
Class
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:cfa00980]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 491 aa AA seqDB search
MDGVSTAILLGLLALAFLFLILNSRGKSQLPPGPRPLPFLGNLLQLRSQDMLTSLTKLSK
EYGSVYTVHLGPRRVVVLSGYQAVKEALVDQGEDFSGRGDYPVFFNFTKGNGIAFSNGDR
WKVLRRFSVQILRNFGMGKRSIEERILEEGSFLLAELRKTEGKPFDPTFVLSRSVSNIIC
SVIFGSRFDYDDERLLTIIRLINDNFQIMSGPWGELYNIFPSLLDWIPGPHRRLFQNFGC
MKDLIARSVRDHQDSLDPRCPRDFIDCFLNKMAQEKQDPHSHFHMDTLLMTTHNLIFGGT
ETVGTTLRHAFLVLMKYPKVQARVQEEIDRVVGRARLPALEDRAAMPYTDAVIHEVQRFA
DVIPMNLPHRVIRDTPFRGFLLPKGTDIITLLNTVHYDPNQFLTPQEFNPEHFLDANQSF
KKSPAFMPFSAGRRLCLGESLARMELFLYLTAILQSFSLQPLGAPEDIDLTPLSSGLGNL
PRPFQLRLRTR
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggatggtgtgagcacagccatcttgctcgggctcctggctctcgcctttctgttcctg
atcctcaattcaaggggcaagagccagctgcccccaggccccagacccctcccattcctg
ggaaacctgctgcagcttcgctcccaagacatgctgacctctctcaccaagctgagcaag
gagtatggctcagtgtacacagtgcacctggggccgagacgcgtggtggtcctcagtggg
taccaagccgtgaaggaggcccttgtggaccaaggggaggattttagtggccgtggtgac
taccctgtctttttcaacttcactaagggcaatgggatcgccttctccaacggggaccgg
tggaaagtcctgaggaggttctccgtccagattctgaggaacttcgggatggggaagaga
agcattgaggagcggatcctggaggaaggcagcttcctgctggcagagctaaggaaaact
gaaggcaagcccttcgaccccacgtttgtgctcagccgctccgtgtccaacatcatctgc
tcggtgatcttcggcagccgctttgactacgatgatgagcgtctgctcaccattatccgc
ctcattaatgacaacttccaaatcatgagcggcccctggggagagttgtacaacatcttt
ccgagcctcctggactggatacctgggccacaccggcgccttttccagaactttgggtgc
atgaaagacctcatcgcccgcagcgtccgcgaccaccaggactccctcgatccccgctgt
ccccgggacttcattgattgtttcctcaacaaaatggcacaagagaagcaggacccgcac
agccacttccacatggataccctgctgatgaccacacataacctgatcttcggtggcacc
gagaccgtgggcaccacgctgcgccacgccttccttgtgctcatgaagtacccgaaagtg
caagcccgcgtccaggaggagatcgaccgcgtggtgggacgcgcgcggctgccggcgctg
gaggaccgagcggccatgccttacacggatgcggtgatccacgaggtgcagcgcttcgcc
gacgtcatccccatgaacttgccgcaccgcgtcattcgggacacaccctttcgcggcttc
ctgctacccaagggcacagatatcatcacccttcttaacacagtccactatgaccccaac
cagttcctgacgccccaggaattcaaccccgagcattttctggatgccaatcagtctttc
aagaagagcccagccttcatgcctttctcagctggtcgccggctgtgcctgggcgagtcg
ctggcgcgcatggagctcttcctctacctcaccgccatcctgcagagcttctcgctgcag
ccgctgggggcgcccgaggacatcgacctgacgccgctcagctccgggctcggcaacctc
ccgcggcctttccagctgcgcctgcgcacgcgctga

DBGET integrated database retrieval system