KEGG   Canis familiaris (dog): 612477Help
Entry
612477            CDS       T01007                                 

Definition
cytochrome P450 2F5-like
Orthology
K07416  
cytochrome P450, family 2, subfamily F [EC:1.14.14.1]
Organism
cfa  Canis familiaris (dog)
Pathway
Metabolism of xenobiotics by cytochrome P450
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    612477
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     612477
Cytochrome P450 [BR:cfa00199]
 Cytochrome P450, animal type
  CYP2 family
   612477
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 491 aa AA seqDB search
MDGVSTAILLGLLALAFLFLILNSRGKSQLPPGPRPLPFLGNLLQLRSQDMLTSLTKLSK
EYGSVYTVHLGPRRVVVLSGYQAVKEALVDQGEDFSGRGDYPVFFNFTKGNGIAFSNGDR
WKVLRRFSVQILRNFGMGKRSIEERILEEGSFLLAELRKTEGKPFDPTFVLSRSVSNIIC
SVIFGSRFDYDDERLLTIIRLINDNFQIMSGPWGELYNIFPSLLDWIPGPHRRLFQNFGC
MKDLIARSVRDHQDSLDPRCPRDFIDCFLNKMAQEKQDPHSHFHMDTLLMTTHNLIFGGT
ETVGTTLRHAFLVLMKYPKVQARVQEEIDRVVGRARLPALEDRAAMPYTDAVIHEVQRFA
DVIPMNLPHRVIRDTPFRGFLLPKGTDIITLLNTVHYDPNQFLTPQEFNPEHFLDANQSF
KKSPAFMPFSAGRRLCLGESLARMELFLYLTAILQSFSLQPLGAPEDIDLTPLSSGLGNL
PRPFQLRLRTR
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggatggtgtgagcacagccatcttgctcgggctcctggctctcgcctttctgttcctg
atcctcaattcaaggggcaagagccagctgcccccaggccccagacccctcccattcctg
ggaaacctgctgcagcttcgctcccaagacatgctgacctctctcaccaagctgagcaag
gagtatggctcagtgtacacagtgcacctggggccgagacgcgtggtggtcctcagtggg
taccaagccgtgaaggaggcccttgtggaccaaggggaggattttagtggccgtggtgac
taccctgtctttttcaacttcactaagggcaatgggatcgccttctccaacggggaccgg
tggaaagtcctgaggaggttctccgtccagattctgaggaacttcgggatggggaagaga
agcattgaggagcggatcctggaggaaggcagcttcctgctggcagagctaaggaaaact
gaaggcaagcccttcgaccccacgtttgtgctcagccgctccgtgtccaacatcatctgc
tcggtgatcttcggcagccgctttgactacgatgatgagcgtctgctcaccattatccgc
ctcattaatgacaacttccaaatcatgagcggcccctggggagagttgtacaacatcttt
ccgagcctcctggactggatacctgggccacaccggcgccttttccagaactttgggtgc
atgaaagacctcatcgcccgcagcgtccgcgaccaccaggactccctcgatccccgctgt
ccccgggacttcattgattgtttcctcaacaaaatggcacaagagaagcaggacccgcac
agccacttccacatggataccctgctgatgaccacacataacctgatcttcggtggcacc
gagaccgtgggcaccacgctgcgccacgccttccttgtgctcatgaagtacccgaaagtg
caagcccgcgtccaggaggagatcgaccgcgtggtgggacgcgcgcggctgccggcgctg
gaggaccgagcggccatgccttacacggatgcggtgatccacgaggtgcagcgcttcgcc
gacgtcatccccatgaacttgccgcaccgcgtcattcgggacacaccctttcgcggcttc
ctgctacccaagggcacagatatcatcacccttcttaacacagtccactatgaccccaac
cagttcctgacgccccaggaattcaaccccgagcattttctggatgccaatcagtctttc
aagaagagcccagccttcatgcctttctcagctggtcgccggctgtgcctgggcgagtcg
ctggcgcgcatggagctcttcctctacctcaccgccatcctgcagagcttctcgctgcag
ccgctgggggcgcccgaggacatcgacctgacgccgctcagctccgggctcggcaacctc
ccgcggcctttccagctgcgcctgcgcacgcgctga

DBGET integrated database retrieval system