KEGG   Canis familiaris (dog): 612559Help
Entry
612559            CDS       T01007                                 

Gene name
PPP3R1
Definition
(RefSeq) protein phosphatase 3 regulatory subunit B, alpha
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04010  MAPK signaling pathway
cfa04020  Calcium signaling pathway
cfa04022  cGMP-PKG signaling pathway
cfa04114  Oocyte meiosis
cfa04218  Cellular senescence
cfa04310  Wnt signaling pathway
cfa04360  Axon guidance
cfa04370  VEGF signaling pathway
cfa04380  Osteoclast differentiation
cfa04625  C-type lectin receptor signaling pathway
cfa04650  Natural killer cell mediated cytotoxicity
cfa04658  Th1 and Th2 cell differentiation
cfa04659  Th17 cell differentiation
cfa04660  T cell receptor signaling pathway
cfa04662  B cell receptor signaling pathway
cfa04720  Long-term potentiation
cfa04724  Glutamatergic synapse
cfa04921  Oxytocin signaling pathway
cfa04922  Glucagon signaling pathway
cfa04924  Renin secretion
cfa05010  Alzheimer's disease
cfa05014  Amyotrophic lateral sclerosis (ALS)
cfa05031  Amphetamine addiction
cfa05152  Tuberculosis
cfa05166  HTLV-I infection
cfa05167  Kaposi's sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    612559 (PPP3R1)
   04310 Wnt signaling pathway
    612559 (PPP3R1)
   04370 VEGF signaling pathway
    612559 (PPP3R1)
   04020 Calcium signaling pathway
    612559 (PPP3R1)
   04022 cGMP - PKG signaling pathway
    612559 (PPP3R1)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    612559 (PPP3R1)
   04218 Cellular senescence
    612559 (PPP3R1)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    612559 (PPP3R1)
   04650 Natural killer cell mediated cytotoxicity
    612559 (PPP3R1)
   04660 T cell receptor signaling pathway
    612559 (PPP3R1)
   04658 Th1 and Th2 cell differentiation
    612559 (PPP3R1)
   04659 Th17 cell differentiation
    612559 (PPP3R1)
   04662 B cell receptor signaling pathway
    612559 (PPP3R1)
  Endocrine system
   04922 Glucagon signaling pathway
    612559 (PPP3R1)
   04921 Oxytocin signaling pathway
    612559 (PPP3R1)
   04924 Renin secretion
    612559 (PPP3R1)
  Nervous system
   04724 Glutamatergic synapse
    612559 (PPP3R1)
   04720 Long-term potentiation
    612559 (PPP3R1)
  Development
   04360 Axon guidance
    612559 (PPP3R1)
   04380 Osteoclast differentiation
    612559 (PPP3R1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    612559 (PPP3R1)
   05014 Amyotrophic lateral sclerosis (ALS)
    612559 (PPP3R1)
  Substance dependence
   05031 Amphetamine addiction
    612559 (PPP3R1)
  Infectious diseases
   05152 Tuberculosis
    612559 (PPP3R1)
   05166 HTLV-I infection
    612559 (PPP3R1)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    612559 (PPP3R1)
Protein phosphatases and associated proteins [BR:cfa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     612559 (PPP3R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Motif
Other DBs
NCBI-GeneID: 612559
NCBI-ProteinID: XP_005626231
Position
10
AA seq 176 aa AA seqDB search
MRGRRRQGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPL
VQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQ
VLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgggaggcggcggcagggaaatgaggcaagttatccgttggaaatgtgctcacac
tttgatgctgatgaaattaaaaggctaggaaagagatttaagaagctcgatttggacaat
tcgggttctttgagtgtggaggagttcatgtctctgcctgagttacaacagaatccttta
gtacagcgagtaatagatatatttgacacagatgggaatggagaagtagactttaaagaa
ttcattgagggagtctctcagttcagtgtcaaaggagacaaggaacagaagttgaggttt
gctttccgtatctatgacatggataaagatggctatatttccaatggggaactcttccag
gtgctgaagatgatggtggggaacaatctgaaagatacacagttacagcagatcgtagac
aaaaccataataaacgcagataaggatggagacgggcgaatatccttcgaggaattctgt
gccgttgtaggcggcctagacatccacaaaaagatggtggtagatgtgtga

DBGET integrated database retrieval system