KEGG   Canis familiaris (dog): 612664Help
Entry
612664            CDS       T01007                                 

Gene name
ASPG
Definition
asparaginase homolog (S. cerevisiae)
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
cfa  Canis familiaris (dog)
Brite
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     612664 (ASPG)
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     612664 (ASPG)
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     612664 (ASPG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
8
AA seq 512 aa AA seqDB search
MARALGPERRLLTVYTGGTIGKRSERNVLVPGRGLAAVLRTLPMFHDEEHARACGLPEDT
LVLPPASPDQRVIYTVLECQPLFDSSDMTITEWVQIAQTIERHYEQYHGFVVIHGTDTMA
FAASVLSFVLENLQKTVVLTGAQVPIHALWNDGRENLLGALLMAGQYVIPEVCLFFQNQL
FRGNRVTKVDSRRFAAFCSPNLPPLAVVGTDVLINRELVRKARGKDRLVVHSSMERDVGL
LRLYPGIPAALVRAFLQPPMKGVVMETFGSGNGPTQPELLGELQAAAQRGLLILNCTHCL
QGAVTSDYAAGMAMAGAGIISGFDMTSEAALAKLSYVLGQPGLSLDGRKELLARDLRGEM
TLPTGHERRPSLSCSTLGRGVAQLLALSQEADAVRDALLPGLACAAAHAGNLEALQALVE
LGSYLSLENYXGSYSCAQGAXGGHAVAVNMLLHRAVPVDTRDEDGLSPLLLAVKGRHRGV
IGLLRAAGACLSPRELEDAGTELCRKSCLVSD
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcgcgctggggcccgagcggcggctcctgaccgtctacaccggcgggactatc
ggcaagcggagcgagcggaatgtgctcgtccccgggaggggcctggccgctgtcttgagg
acactgcccatgttccatgatgaagagcacgcccgggcctgtggcctccctgaggacacc
ctggtgctgccgccggccagccctgaccagagagtcatctacacggtgctggagtgccag
cccctctttgactccagtgacatgaccatcaccgagtgggttcagattgcccagaccatc
gagagacactatgagcagtaccacgggttcgtggtcatccacggcactgacaccatggcc
ttcgcggcctccgtgctctccttcgtgctggagaacctgcagaaaaccgtcgtcctcact
ggcgcccaggtgcccatccatgccctgtggaacgatggccgagagaacctgctgggggcc
ctgctcatggccggccagtacgtgatccccgaggtctgtctgttcttccagaatcagctg
tttcggggcaaccgagtgaccaaggtggactcgcgcaggtttgcggccttctgctccccc
aacctgccccctctggctgtcgtgggcactgacgtcctaatcaaccgggagctggtgcgg
aaggcccgaggcaaggaccggctggtcgtgcacagcagcatggagcgggacgtgggcctg
ctgcgcctctaccccgggatccccgccgccctggtccgggccttcctgcagccccccatg
aagggcgtggtcatggagacgttcggctcggggaacgggcccacgcagcccgagctgctg
ggggagctccaggcggcggcgcagcgaggcctcctcatcctcaactgcactcactgcctc
cagggcgccgtgacctccgactacgcggccggcatggccatggcgggcgccggcatcatc
tcaggcttcgacatgacgtcggaggcggcgctggccaagctgtcctatgtgctgggccag
ccggggctgagcctggacggcaggaaggagctgctggcccgggacctgcgcggggagatg
acgctgcccacgggccacgagcgccggccctccctgagctgcagcacgctgggccggggg
gttgcccagctcctcgctctgagccaggaggccgacgccgtgcgggacgctctgctgcct
ggtctggcctgtgccgcggcccacgctggcaacctggaggcgctgcaggcgctcgtggag
ctgggcagctatctgagcctagagaactacnnagggtcatactcgtgtgcacagggcgcc
tgaggaggccacgctgtcgcggtcaacatgctgctgcacagggcggtgcctgtggacacc
cgagatgaggacggactcagcccgctgctgctggccgtgaagggcaggcatcggggtgtc
attgggctgctgcgggcagctggggcctgcctgtccccccgggagctggaagacgcgggg
acggagctgtgcaggaagtcctgcctggtgtctgactga

DBGET integrated database retrieval system