KEGG   Citrobacter farmeri: CI104_22250Help
Entry
CI104_22250       CDS       T05012                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
cfar  Citrobacter farmeri
Pathway
cfar00052  Galactose metabolism
cfar00500  Starch and sucrose metabolism
cfar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfar00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CI104_22250
   00500 Starch and sucrose metabolism
    CI104_22250
Enzymes [BR:cfar01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     CI104_22250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-ProteinID: AST81618
UniProt: A0A223JWT6
Position
4496365..4497798
Genome map
AA seq 477 aa AA seqDB search
MTQSRLHAAHKALAQLRERRGNTFYPHFHLAPPAGWMNDPNGLIWFNDRYHAFYQHHPFN
EHWGPMHWGHATSEDMIHWCHEPIALAPGDEDDKDGCFSGSAVDDNGVLSLIYTGHTWLA
GEGNDDAIREVQCLATSRDGIHFEKQGVVLTPPEGIMHFRDPKVWREANTWWMVVGAKDP
GNTGQILLYRGKSLREWTFDRVLAHAHAGESYMWECPDFFRPGEHHYLMFSPQGMKAEGY
RNRNRFQSGVIPGFWSPGRIFAQSGPFTELDHGHDFYAPQSFCAKDGRRIIIGWMDMWES
SMPSKREGWAGCMTLARELSESNGKLIQRPVREAESLRQLYQPVPADKIDSKRVLQENAQ
AVEIQLRWDCQKSHAEHYGLQLGTGMRLYIDNQSGRLVLWRYYPQENIDGYRSIPLTQDE
PLDLRIFIDKSSIEVFINDGEAVMSSRIYPQPEERELSLYAAHGEATLLQGRLWLLG
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaatctcgtttacatgcggcgcataaggcgctggcacaacttcgcgagcgccgg
ggtaacaccttctatcctcattttcacctcgcgcctccggctgggtggatgaacgatccc
aacgggctaatctggtttaacgatcgctatcacgcgttttatcagcatcacccattcaac
gaacactgggggcctatgcactggggacatgccaccagtgaagatatgatccactggtgt
catgagcctattgcgctggcacctggcgatgaggatgacaaagatggatgtttttcgggc
agtgccgtcgatgacaacggtgtgttatcgctcatctacaccggccatacctggcttgca
ggcgaaggcaatgatgacgccattcgtgaagtgcagtgtctggcaaccagtcgggatggg
atccattttgaaaaacagggtgtggtgctgaccccgccggaaggaattatgcattttcgc
gatcctaaagtctggcgagaagcaaacacctggtggatggtggtaggtgcaaaagatcct
ggtaacaccgggcagatcttactttatcgtggtaaatcattgcgtgaatggaccttcgat
cgcgtactggcgcatgcccacgcaggtgaaagctacatgtgggagtgtccagactttttc
cgtcctggtgaacaccattacctgatgttttcaccacaaggaatgaaggcggaaggatac
cgtaaccggaatcgctttcagagcggagtcatccctgggttctggtctcctggacggatc
tttgcccagtcgggcccttttactgaactcgatcacgggcatgatttttatgcgccgcaa
agcttttgcgctaaagatggcaggcgcatcatcatcggctggatggatatgtgggaatcg
tcaatgccatcaaaacgtgaaggttgggcaggttgtatgacgctggctcgggagctctct
gagagcaacggcaaactcatccagcgcccggtgcgggaagcagagtcgttacgccagctg
taccaacctgtgcctgccgacaaaatcgacagcaaacgcgttttgcaggaaaacgcacaa
gcggtcgaaattcaattacgctgggattgtcagaaaagtcatgccgaacattacgggtta
caactcggcactgggatgcgactgtatatcgataatcagtccggacggctcgttttgtgg
cggtattacccacaagaaaacatagatggttaccgtagtattccccttacgcaggatgaa
cccctcgatctgaggatctttatcgataagtcatccattgaggtattcattaatgatggg
gaagcggtcatgagcagccgaatctatccgcagccagaggaacgagaactgtctctctat
gccgctcatggagaagccacactgctgcaaggcagactctggctactggggtaa

DBGET integrated database retrieval system