KEGG   Citrobacter freundii: CFNIH1_00310Help
Entry
CFNIH1_00310      CDS       T03077                                 

Definition
4-aminobutyrate aminotransferase
Orthology
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
cfd  Citrobacter freundii
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CFNIH1_00310
   00650 Butanoate metabolism
    CFNIH1_00310
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CFNIH1_00310
   00280 Valine, leucine and isoleucine degradation
    CFNIH1_00310
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CFNIH1_00310
Enzymes [BR:cfd01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CFNIH1_00310
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     CFNIH1_00310
Amino acid related enzymes [BR:cfd01007]
 Aminotransferase (transaminase)
  Class III
   CFNIH1_00310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
68638..69921
Genome map
AA seq 427 aa AA seqDB search
MSTNKELMQRRSNAVPRGVGQIHPIFAERAENCRVWDVEGREFLDFAGGIAVLNTGHLHP
QIVSAVEAQLKKLSHTCFQVLAYEPYLELCEIMNKKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRTGTIAFSGAYHGRTHYTLSLTGKVNPYSAGMGLMPGHVYRALFPCPLHGISE
DDAIASIHRIFKNDAAPEDVAAIVIEPVQGEGGFYAVTPAFMQRLRAICDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRADVMDAIPPGGLGGTYAG
NPIACAAALAVLNIFEQENLLQKANELGQTLREGLLAIAETHREIGDVRGLGAMIAIELF
EDGDHTKPDAKLTAEVVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLDIIAQC
FAEAKQG
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccaacaaagaactcatgcaacgtcgcagcaacgccgttccccgtggcgtagga
cagatccaccctatttttgccgagcgggcagaaaactgccgggtctgggacgttgaaggc
cgcgaattcctcgattttgctggcggtattgcggtgctgaataccggtcacctgcacccg
cagattgtctctgcggtagaagcgcagttgaaaaaactgtcgcatacctgcttccaggtg
ctggcctatgagccctacctggagctgtgcgaaatcatgaacaagaaagtgccgggcgat
ttcgccaagaaaaccctgctggtgaccaccggttctgaagccgtggaaaacgcggtgaaa
attgcccgcgccgccaccaaacgtacaggtacgatcgccttcagcggcgcttatcatggc
cgtacccactacaccctgtcgctgaccgggaaagtcaacccgtactccgccggaatgggg
ctgatgccgggccatgtttatcgcgcactttttccttgcccgctgcatggcatcagtgaa
gatgatgctatcgccagtattcaccgcatcttcaaaaatgatgccgcgccggaagacgtt
gccgccatcgtcattgaacccgtccagggcgaaggcggtttttacgcggtcaccccggca
tttatgcagcgtctgcgcgccatttgtgacgaacacgggatcatgctgattgccgatgaa
gtgcagagcggcgcgggccgcaccggtacgctgttcgccatggagcagatgggcgttgcg
cccgatcttaccaccttcgccaaatctatcgctggcggcttcccgctggcaggggtaacc
ggtcgcgccgacgtcatggacgctatcccgccgggtggcctgggcggtacctatgccggt
aacccgattgcctgtgccgccgcgctggcggtgctgaacattttcgagcaggaaaatctg
ctgcaaaaggccaacgaactggggcaaaccctgcgcgaaggcctgctggctatcgccgaa
acgcatcgcgaaattggcgacgtgcgtgggctgggggcgatgatcgccatcgaactgttc
gaagacggcgaccatacgaaaccagacgccaagctgaccgcagaagtggtggcgcgcgcg
cgtgataaagggctgatcctgctctcctgcgggccttactacaacgtgctgcgcatcctt
gtcccgctgaccattgaagatgcgcaaatccgccaggggctggacatcatcgcccagtgt
tttgctgaggcgaagcagggctaa

DBGET integrated database retrieval system