KEGG   Citrobacter freundii: CFNIH1_04365Help
Entry
CFNIH1_04365      CDS       T03077                                 

Definition
lysozyme
Orthology
K13381  
bifunctional chitinase/lysozyme [EC:3.2.1.14 3.2.1.17]
Organism
cfd  Citrobacter freundii
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cfd00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CFNIH1_04365
Enzymes [BR:cfd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     CFNIH1_04365
    3.2.1.17  lysozyme
     CFNIH1_04365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
Position
complement(879936..882026)
Genome map
AA seq 696 aa AA seqDB search
MQLNLATKALFCMGLTCAALPAFALEAWSGQEGGSTYEVIFDSGVYSNAWWVGASDCPGN
AAGDEANNPWRYERAATADEITKYGNPTTCDTGGGTVTYPAYDNSIAYNAGDIVIYNNAT
YKTSVAQSAYGFAPGQENPWEAYAVVTQWASSTVYNKGDKVQKNGQEYEALFYTVGDDPS
LPANQNPTGTNGRPWKPLGAVVSYTQDQLNKAPEYNSSTVYESGTLIRYNGGNYVSQSKV
QKVSPSDTNPWRVFIDWTGTKEKVGTPKSPWPAHVYAPYVDFTLNSQPDLASLAQNQNVT
HFTMAFVVSKDADTCLPTWGTAYNVNDYAQYSKIKALREAGGDIMVSIGGANNSPLAASC
KNVNDLKQHYYDIVDNLNLNVLDFDIEGTWVADHESINRRNEAVKAVQDTWKAEGRSVGI
WYTLPILPTGLTAEGLYVLEDAKAKGVELAGVNVMAMDYGNSICQSDGTEGQNIHGKCAT
SAIENLHSQMKQIFTDKSDAEINAMMGTTPMIGYNDVQGEVFYMSDAKLVMQDATDRGLG
MIGIWSMMRDQPGVARQVSPEHSGLTEQQAAKYAFSEVFAPFTKAGSELPDGVISFTVTA
APGNRHAQIKLTKEAFNTRKFVVYQNYKTNKKYMGHSEKGLSYYGHNWSADNGENTVAEF
YYYSTPKAGDTVTLVEDDYSKETVLQEVTISSDMLK
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atgcaattaaatctcgcaacaaaagccttattttgtatggggctgacatgtgctgccttg
ccagcatttgccctggaagcatggagcggtcaggaaggcggcagtacgtatgaagtgatt
ttcgacagcggcgtgtatagcaatgcgtggtgggtaggtgcatcggattgtccgggaaac
gccgcgggcgacgaagcgaataacccatggcgctacgagcgagcagcgaccgctgatgaa
ataacgaaatatggtaatccaacaacctgcgatacgggtggcggtacggtaacttaccca
gcatatgacaatagtatcgcttataatgctggtgatattgttatttataataatgcgacg
tataaaacgtctgtcgcgcaaagcgcttatggttttgctcctggtcaggaaaatccatgg
gaggcttatgccgttgtcacgcaatgggcgtcctcgaccgtctataataaaggcgataaa
gttcagaaaaatggccaggaatatgaagccctgttttataccgtaggggatgatccttct
cttccagctaatcaaaacccaactggcacaaatggtcgtccatggaaaccactgggcgct
gttgtctcttatactcaggaccagttgaataaagctccagaatataattcctccactgta
tatgaaagcggcacgctgatccgctataacggtggtaattacgtttcgcagtccaaagta
cagaaagtctccccatctgataccaatccatggcgcgtgtttatcgactggaccggcacc
aaagaaaaagtaggcacgccgaagtcaccatggcctgcgcatgtctatgccccatatgtc
gattttaccctcaactcacagccggatctggcaagccttgcgcagaaccagaatgtcacc
cacttcaccatggctttcgtggtcagtaaagatgctgatacctgcctgccgacatggggt
accgcatataacgttaacgactacgctcagtacagcaaaattaaagcgctgcgtgaagca
ggtggcgacatcatggtttccattggcggagcgaataactccccactggcagcgtcttgt
aagaatgtgaatgacctgaagcagcattattacgatatcgtagacaacctgaatcttaac
gtgctggacttcgatattgaaggcacctgggttgcggatcatgaatccataaaccgtcgt
aatgaagcggtgaaggctgttcaggacacctggaaagcagaaggtcgtagcgtcggaatt
tggtacaccttgcctattctgccgacgggcctgacggctgaaggtctttatgtacttgaa
gatgcgaaagccaagggcgttgaactggctggtgtcaacgtcatggcgatggattacggt
aacagcatttgccagtctgatggtactgaaggccaaaacattcatggcaagtgtgcgaca
tccgccattgaaaacctccatagccagatgaagcagattttcactgacaagagcgatgcg
gaaattaacgccatgatgggtacgacgccgatgatcggttacaacgacgttcagggcgaa
gtgttttatatgtctgatgcgaaactggtgatgcaggatgccactgatcgtggtctgggc
atgattggcatatggtctatgatgcgcgatcagcctggcgtcgccaggcaggtttcccct
gagcacagcggtctgaccgaacagcaggctgcgaaatacgcctttagcgaagtttttgca
ccgtttacgaaagcaggaagcgaattgccagacggtgtgatttctttcaccgtcacagct
gcgccaggtaacagacatgcacaaattaaactgacgaaagaagcgtttaatacccgcaag
tttgttgtatatcaaaactataaaacaaacaaaaagtatatggggcattcagaaaaaggc
ctcagctattatgggcacaactggtctgcagataatggtgaaaataccgttgccgaattc
tattactactctacgccgaaagcgggtgataccgtaacattagttgaagatgactatagt
aaagaaacggtattacaagaagttacaattagcagcgatatgctgaagtaa

DBGET integrated database retrieval system