KEGG   Citrobacter freundii: CFNIH1_05465Help
Entry
CFNIH1_05465      CDS       T03077                                 

Gene name
malS
Definition
alpha-amylase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
cfd  Citrobacter freundii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CFNIH1_05465 (malS)
Enzymes [BR:cfd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CFNIH1_05465 (malS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
1121208..1123238
Genome map
AA seq 676 aa AA seqDB search
MKLAAVALALMPGIAIASTWTSQGLPAFEAEGTGKFVSHAALTKGTRPLILNFDQQCWQP
ADAIKLNQMLSLKPCEGAPPQWRLFKDGDYTLEVDTRSGTPTLMLSVKSAADPVSSQIRQ
CPKWDGSPLTLDVSQTFPEGAVVRDYYSNQTATVKNGSITLQPAATSNGLLLLERAETDA
PAAFDWHNATVYFVLTDRFVNGDPGNDHSYGRRNDGMQEIGTFHGGDLRGLASKLDYLQQ
LGVNALWISAPFEQIHGWVGGGTKGDFPHYAYHGYYTQDWTTLDANMGNENDLRALVDGA
HQRGIRVLFDVVMNHTGYATLADMQEYQFGALYLSGDELKNTLGERWTDWKPSAGQSWHS
FNDYINFSDKAGWEKWWGKNWIRTDIGDYDNPGFDDLTMSLAFLPDLKTESTTPSGLPNF
YQHKPDTHAKAIAGYTPRDYLTHWLSQWVRDYGIDGFRVDTAKHVELPAWQQLKTQASAA
LVEWKKAHPDKALDDNPFWMTGEAWGHGVMQSDYYRHGFDAMINFDYQEQAAKAVDCLAN
MDLTWQQMAEKLQDFNVLSYLSSHDTRLFREGGDKAAELLLLAPGAVQLFYGDESARPFG
PTGSDPLQGTRSEMNWQDVTGKSAASVAHWQRISQFRARHTAIGAGQQTTLTLKQGYGFV
REHGNDKVMVVWAGQP
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttgccgccgttgcgctggcgctaatgcccggcattgccatcgcctcaacatgg
acttctcagggacttcccgccttcgaagcggaaggtacgggtaaattcgtcagccatgca
gcgttgacgaagggtactcgtcctttaattctgaattttgaccaacagtgctggcagcca
gctgacgcgataaaactcaaccagatgctgtcgcttaaaccttgtgaaggcgcgccgccg
cagtggcgtttattcaaggacggcgattacacgctggaagtcgatacccgctccggcacg
ccaacgctgatgctctcagtcaaaagcgccgcagaccccgtcagtagccaaattcgccag
tgtccgaaatgggatggttcgccattaacgctggacgtcagtcagaccttcccggaaggc
gccgtggtgcgcgactactacagcaaccaaacggcgacggtaaaaaacgggtcgattacc
ctgcagcccgccgcaaccagtaacgggttgttgctgctggaacgagcggaaaccgacgcc
cccgccgctttcgactggcataacgcgacggtgtatttcgtcctgacggaccgctttgtg
aatggcgatccgggcaatgaccacagctacggtcggcgcaacgacggtatgcaggaaatt
ggcaccttccacggcggcgatttacgcggtcttgccagcaaactcgactatctgcaacaa
ctgggcgtcaatgcgttatggatcagcgcgccgtttgagcaaatccacggctgggtcggc
ggtggcaccaaaggcgatttcccccactacgcctaccatggctactacactcaggactgg
accacgctcgacgccaatatgggcaacgaaaacgatctgcgcgcgctggttgacggcgct
caccagcgcggcatccgtgtcctgtttgatgtcgtgatgaaccatactggctacgccacg
ctggcggatatgcaggaatatcagtttggggcgctgtacttatcaggcgatgagctgaaa
aacacgctcggcgaacgctggacggactggaagccatctgccgggcagagctggcatagc
tttaatgattacatcaacttcagcgataaagccggttgggaaaaatggtggggcaaaaac
tggatccgcaccgatattggcgattacgacaaccctggttttgacgacctgaccatgtcg
ctggctttcctgcccgatctgaaaaccgaatccaccacgccttccggcctgcctaatttt
tatcagcacaaaccggatactcacgccaaagcgatcgccggctacacgccccgcgattat
ctgacccactggctcagtcagtgggtgcgcgattacggaattgacggctttcgggtcgat
accgccaaacacgtcgagcttcccgcctggcagcagctcaaaacacaggccagcgcggcg
ctggtcgaatggaagaaagcccacccggacaaagccctggatgataaccccttctggatg
accggtgaagcctggggtcacggcgtcatgcaaagcgactattatcgtcacggtttcgac
gcgatgatcaatttcgactatcaggagcaggcggcgaaagccgttgattgtctggcaaat
atggatctcacctggcaacagatggcggaaaaactgcaggatttcaatgtcctgagctat
ctctcctcccatgatacccggctgtttcgcgagggtggagacaaagccgccgagctattg
ctgctggcgcctggggcagtacaactgttttacggtgacgagtcggcccggcctttcggc
cccacggggtccgatcccttgcagggtacgcgctcagagatgaactggcaggacgtgacc
gggaaatctgccgccagcgtggcacactggcaacgtatcagccagttcagggccagacat
accgccattggcgccggtcaacaaaccacactgacattgaagcaggggtacggattcgtc
cgtgaacatggcaacgataaagttatggtggtgtgggccggtcagccctga

DBGET integrated database retrieval system