KEGG   Citrobacter freundii: CFNIH1_07375Help
Entry
CFNIH1_07375      CDS       T03077                                 

Definition
phosphoenolpyruvate carboxylase (EC:4.1.1.31)
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cfd  Citrobacter freundii
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cfd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CFNIH1_07375
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CFNIH1_07375
  Energy metabolism
   00680 Methane metabolism
    CFNIH1_07375
Enzymes [BR:cfd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CFNIH1_07375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(1514903..1517554)
Genome map
AA seq 883 aa AA seqDB search
MNEQYSALRSNVSMLGKVLGETIKDALGEHILDRVETIRKLSKSSRAGNEVNRQELLTTL
QNLSNDELLPVARAFSQFLNLANTAEQYHSISPKGEAASNPEVIARTLRKLKDQPNLDEA
TIKKAVESLSLELVLTAHPTEITRRTLIHKMGEVNTCLKQLDNKDLVDYERHQLMRRLRQ
LIAQSWHTDEIRKIRPSPVDEAKWGFAVVENSLWEGVPNYLRELNEQLEENLGYKLPVDF
VPVRFTSWMGGDRDGNPNVTADITRHVLLLSRWKATDLFLKDIQFLISELSMVDATPELL
ALVGEEGAAEPYRYLMKTLRSRLMATQAWLEARLKGEKLPKPAGLLTQNEQLWDPLYACY
QSLQACGMGIIANGELLDTLRRVKCFGVPLVRIDIRQESTRHTEALGELTRYLGIGDYEN
WSEADKQAFLIRELNSKRPLLPRNWEPSNDTREVLDTCRVIAEAPYGSIAAYVISMAKTP
SDVLAVHLLLKEAGIGFAMPVAPLFETLDDLNNADDVMSQLLNIDWYRGFIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIELTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTISSLSLYTAAILEANLLPPPEPKDNWRHIMDEL
SDISCELYRGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFA
WTQNRLMLPAWLGAGTALQKVVEDGKQSELEAMCRDWPFFSTRLGMLEMVFAKADLWLAE
YYDQRLVKKELWPLGEELRQRLAADIDVVLAIANDSHLMADLPWIAESIQLRNVYTDPLN
VLQAELLHRSRLAEEQGNAPDPRVEQALMVTIAGVAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcgttgcgtagtaatgtcagtatgctcggcaaagtgctggga
gagaccattaaggatgcgctgggagagcacattcttgatcgcgtagaaacaatccgtaag
ctgtccaaatcatcccgcgctggcaatgaagtcaatcgccaggagctacttacgacgctg
caaaacctgtctaacgacgaactgctgccggttgcccgtgcgtttagccagttcctgaac
ctggccaacaccgccgagcaataccacagcatttcgcccaaaggcgaagcagccagcaac
ccggaagtgattgctcgcactctgcgtaaattgaaagaccagcccaatctcgatgaagcc
accatcaaaaaagccgtggagtcactctccctggagctggttctgaccgcacacccgaca
gaaatcacccgtcgtacgttgatccataaaatgggtgaagtaaacacctgtctcaaacag
cttgataacaaagatctcgtcgattatgaacgccatcaactgatgcgccgtctgcgccag
ttgattgcccagtcctggcatacggatgagatccgcaagatacgcccaagcccggttgat
gaagccaaatggggcttcgccgtggtcgaaaacagcctgtgggaaggcgtgccgaactat
ctgcgcgagctgaacgaacagttagaagagaatctgggttataagctgcccgttgatttt
gttccggttcgctttacctcctggatgggcggcgaccgtgacggcaacccgaacgtgacg
gcggatatcacccgtcacgtgctattactcagccgttggaaagccaccgacctgttcctg
aaagacattcagtttctgatctctgaactgtcgatggtggatgccacgccggaactgctg
gcgctggtcggcgaagaaggcgcagcagaaccataccgttatctgatgaaaaccctgcgt
tcacgtctgatggcaactcaagcctggctggaagcccgcctgaaaggcgagaaattaccg
aaacctgccggccttctcacccaaaacgaacagctctgggatccgctgtacgcgtgttac
cagtctctgcaagcctgtggcatgggcatcatcgccaatggcgaactgctcgacaccttg
cgccgcgtgaaatgtttcggcgtgccgctggtacgtattgatattcgtcaggaaagcacc
cgccacactgaagcgctgggcgaactgacccggtatctgggcattggcgactacgaaaat
tggtcagaagcggataaacaggctttcttgatccgcgaactgaactccaagcgtccgctt
ctgccacgtaactgggaaccaagcaatgacacccgcgaagtgctcgacacctgccgcgtc
attgccgaagctccgtatggctccattgccgcctatgttatctcgatggcgaaaacgccg
tccgatgtattggccgtacatctgctgctgaaagaagccgggatcggttttgctatgccg
gtggcgccgctgtttgaaacactggacgacctcaacaatgctgatgacgtcatgtcccag
ctcttgaatattgactggtaccgcggctttattcagggcaaacagatggtcatgattggc
tactctgactctgcaaaagacgcgggggtaatggcggcctcctgggcgcaatatcaggct
caggacgcgttgatcaaaacgtgtgaaaaagccggaatcgagctgacgctgttccatggc
cgcggtggttccattggtcgcggcggcgcgcctgcgcatgccgcactgctttctcaaccg
cctggcagcctgaaaggtggcctgcgcgtgacggaacaaggtgagatgatccgctttaag
tatggcctgccggaagtgaccatcagcagcctgtcgctatataccgcagccatcctcgag
gccaacctgttaccgccgccagagccgaaggataactggcgccatatcatggatgagctt
tctgatatctcgtgtgagctctaccgtggatatgtacgtgaaaacaaagacttcgtccct
tacttccgctccgcaaccccagagcaggaactgggtaaattgccgctcggctcacgtccg
gcaaaacgccgcccgactggtggggtagagtctctgcgcgccattccatggatctttgcc
tggacgcagaaccgcctgatgctcccggcatggctgggggcaggcaccgcgctgcaaaaa
gtggtggaagacggtaagcaaagcgaactcgaagcaatgtgccgcgactggccattcttc
tccacacgccttggcatgctggaaatggttttcgctaaagcagacctgtggctggctgaa
tactacgatcaacgtctggtcaaaaaagagttgtggccgctcggcgaagaactgcgtcag
cgcctggcagcagatatcgacgtcgtgctggcgattgccaatgactcacatttgatggcc
gacctgccgtggattgccgagtccatccagttaaggaatgtttataccgatccgctgaac
gttttacaggcagagctgttacaccgctcgcgcctggcggaagagcaaggcaatgcgcca
gatccacgcgttgaacaagcgctgatggtaaccatcgcaggtgttgctgccggtatgcgc
aatacaggctaa

DBGET integrated database retrieval system