KEGG   Chlamydophila felis: CF0015Help
Entry
CF0015            CDS       T00332                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cfe  Chlamydophila felis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cfe00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:cfe00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14366..14854
Genome map
AA seq 162 aa AA seqDB search
MCKILGIVACSPSGVIGNQGKLPWSYSKDIEFFAKTIENKPLVMGRKTWEGLPEKYTKGR
QIFVFSRSFYDNAEGVIWVSSLEEFFSLELPPSVFLIGGGDLFSLFLENQLLTGCFVTHI
HRCYDGDAFFPLSLLVGWNKTILDEQEDLTFCYYESLADSHT
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaaaatacttggtattgtagcttgtagtcctagtggggtgattggaaaccaagga
aagttgccttggagctattctaaggacattgaatttttcgcaaaaacgatagaaaacaag
cccttagttatggggagaaaaacctgggagggtcttcctgaaaaatatacgaagggccgt
cagattttcgtgttttctagaagtttttatgacaatgccgagggagttatttgggtgtct
tcgttagaggagttttttagtttagaacttccaccctccgtctttctcataggtggtggg
gacttgttttctttgtttttagaaaatcaacttctgacaggttgttttgtaactcacatt
catcgatgttatgatggtgatgctttctttcccctgtctttattggtggggtggaacaag
actattttagatgaacaagaggatttgacgttttgttattatgaaagtctcgccgatagt
cacacgtag

DBGET integrated database retrieval system