KEGG   Chlamydophila felis: CF0173Help
Entry
CF0173            CDS       T00332                                 

Gene name
dsbD1
Definition
(RefSeq) thioredoxin/thiol-disulfide isomerase
  KO
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
cfe  Chlamydophila felis
Brite
Enzymes [BR:cfe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CF0173 (dsbD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
205630..206139
Genome map
AA seq 169 aa AA seqDB search
MKRWLQGSLIALCLLLTLPCCAAKKRSHYQKDFGKLKIQEVKASGVLWESYANAVEQSKK
DKKYIGLFFTGSDWCIWCIKMQDQILNTPEFQQYAKDNLHMVELDFPQSNSQPEDVKQQN
QALKSKYGVNGFPTLVFIDANGNEKVRMGFEYGGGDNYVKKIQAALHKK
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgctggttgcaaggaagcttaattgctctctgtttattactcaccctgccttgt
tgtgcagcaaaaaaacgttctcattatcaaaaggacttcggcaagctcaagattcaagag
gtgaaagcttcgggggtactctgggaaagttatgctaatgctgttgaacaatctaagaaa
gataagaaatatataggtttatttttcacaggttctgattggtgtatctggtgtattaag
atgcaagatcagattttaaatactcccgaatttcaacaatatgctaaagacaacctacac
atggtagagttagattttccacaatctaatagtcagcctgaggatgtaaaacagcaaaac
caagctctaaaatccaaatacggtgtaaatggatttccaacattagtatttatcgatgct
aatggaaatgagaaagtcagaatgggatttgagtacggtggtggagataattatgtgaag
aaaatccaagctgctttgcataaaaaatag

DBGET integrated database retrieval system