KEGG   Chlamydophila felis: CF0177Help
Entry
CF0177            CDS       T00332                                 

Gene name
dsbD2
Definition
thioredoxin/thiol-disulfide isomerase
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
cfe  Chlamydophila felis
Brite
Enzymes [BR:cfe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CF0177 (dsbD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
209802..210848
Genome map
AA seq 348 aa AA seqDB search
MFLLQIIKKYSLRQLKVLTAFLLGASSISLHGVVHENSSQLVWYVDYNEAVKKSQSSALP
MLIFFSGSDWNAMCMKIRKEVLASSEFSKKVNGNFVCLEVDFPKYSSQSETLRSQNSYLK
TKFKIDEFPCLLLLSHDGREIYKISSFGNETGYNLGESLCHMVENDFLIANADSCIHTLS
MEDLQKYYKIAEELSHKNFMAKALELGVSNDDYFFLSTKYRLLVESGRMDSEECQRVKRK
LLNKDPQNEKLTHFTVALIEFQELAKRSQEGVRQDPSQVIAPLESYLTEFGQQDQENVWR
IEMMIAQFYLDSDQWKNALQHAEVAFETAPKEVRSHISHSLDYIRHQS
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtttctattacagattataaagaaatattctttgaggcaactgaaggtattgacagcg
tttctattaggtgcaagttctattagtttgcatggcgttgttcatgagaattcttctcag
cttgtttggtacgtagattataatgaggcggtgaaaaaaagccaaagttctgcattgcca
atgttgatctttttttccggttccgattggaacgctatgtgcatgaaaattcgtaaagag
gtccttgcttcttcagaattttctaaaaaggtaaatggcaacttcgtatgcttagaagtc
gattttcctaaatattcctcacaaagtgaaaccctacgttcacagaactcatatctaaaa
actaaattcaaaatagacgaattcccttgtcttcttttactttctcatgacggaagagag
atttataaaatcagctcttttggaaatgaaactgggtacaacttaggcgaaagtctctgc
catatggttgaaaacgatttcttaatagccaacgctgattcctgcattcatacgttgtct
atggaagatcttcagaagtactacaagattgctgaagagttgtctcacaaaaatttcatg
gcaaaagctttggaattaggtgtaagcaacgacgattacttcttcttatcaacaaaatat
cgtcttcttgttgaaagtggcagaatggattctgaggaatgccaaagagtaaaacgtaag
ctactcaataaagatcctcaaaacgaaaagctcacacactttactgtcgccttgattgag
tttcaagaactagcaaagagatcccaagagggcgtgcgtcaggatcctagtcaagtaatt
gcccccctcgaatcttatttgacagagtttggacaacaagatcaggaaaatgtctggaga
attgagatgatgatagctcaattttacttagattctgatcaatggaagaatgctttgcaa
cacgctgaagttgctttcgaaacagctcctaaagaggtgcggtctcacatttctcattct
ttggattatattcgacaccagtcgtaa

DBGET integrated database retrieval system