KEGG   Chlamydia felis Fe/C-56: CF0358Help
Entry
CF0358            CDS       T00332                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cfe  Chlamydia felis Fe/C-56
Pathway
cfe00230  Purine metabolism
cfe01100  Metabolic pathways
Module
cfe_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cfe00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CF0358 (gmk)
Enzymes [BR:cfe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CF0358 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_22 AAA_16 Thymidylate_kin AAA AAA_33 TsaE AAA_30 Cytidylate_kin AAA_23 Zeta_toxin MMR_HSR1 ABC_tran Rad17 DUF99 cobW
Motif
Other DBs
NCBI-ProteinID: BAE81130
UniProt: Q255A8
Position
420262..420876
Genome map
AA seq 204 aa AA seqDB search
MKDKVSFPFSPDRPLCVPKLFTISAPAGAGKTTLVRMLAEEFPDSFQKTVSLTTRSPRPE
EVHGVDYYFVSQEEFLKRLDSGDFLEWVALFGEYYGTSRLEIDKIWKSGKHAIAVIDVEG
ALALRSKIPTVTIFISAPSLEELERRLKHRGSEQDAQRQERLQHSLIEQAASSKFEYVII
NDDLEKSYEILKSIFIAEEHRNVL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaagataaagttagtttccccttttctcccgatcgacctctgtgtgtaccgaagcta
tttactattagtgctcctgccggagcggggaaaactacgctagtgcgtatgttagcagag
gaattcccggattcttttcaaaaaactgtgtcattaacaacgcgatcgcctcgtcctgaa
gaagttcacggtgtagattattattttgtttctcaagaagagtttctgaaacgattagat
agtggtgattttctagaatgggtagctcttttcggagaatattacggaactagtcgttta
gaaattgataaaatttggaaatctggaaaacacgcgattgcagtgattgatgtggaggga
gctttagctttacggagtaaaattcctaccgtgactatttttatttccgctccctccctg
gaagaattagaaaggcgtttaaaacatagaggatctgaacaagatgctcaaagacaagaa
cggttgcagcacagtctcatagaacaagctgcttccagtaaatttgaatacgtcattatc
aatgatgatttggaaaaatcttacgagattttgaaaagtatttttatagcagaagaacat
aggaacgtattatga

DBGET integrated database retrieval system