KEGG   Chlamydophila felis: CF0361Help
Entry
CF0361            CDS       T00332                                 

Gene name
recD2
Definition
ATP-dependent dsDNA/ssDNA exodeoxyribonuclease V alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cfe  Chlamydophila felis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cfe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CF0361 (recD2)
Enzymes [BR:cfe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CF0361 (recD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(422831..425041)
Genome map
AA seq 736 aa AA seqDB search
MEKISGKLEGVLFEDHDSKETVARIRIPYKGTLVVIKGQFPDFFLQIGMQLHLYGKWSEN
PNLGQYFQVYSCDSQEMRDNRGIINYLTSKLIKGIGPKITEKILEKFQNDTAYILDNHPE
RLIEVPGISKNRCDNLCAQLREQKDLRTTLLFLQQYDIAIHYGVKIFKKYKEHAIEKICE
DPFLLAREMEGIGFKTADLIATRLGVPLNSQSRLFAGIQHALEELQEDGHTCYPLQGLAQ
AVEKLLNQDIPEKLIQIEEIISQVHLMQEKNILHIQELETTPHVWTKHIYLAEKTVVSDL
KRILFSSRKIRSIDGNKAIQWVENNLNLHLEQNQKEAVRACFSEKIHIITGGPGTGKSTI
TKSILKIFEQVTYKIILAAPTGKAAKRMTEITGKHSVTIHALLQYDFKTRSFRKNYENPI
DCDLIIVDESGMMDTYLLYHFLKALPDHAIVIFIGDVHQLPSIGPGNILKDIINSRKITV
TKLNKIFRQVHDSNIITNAHKVNAGEFPILHSESGRKDFLFFQKEDPQEAVDHIVHLVTQ
FIPKKYHIYPKDIQILAPMKKGILGIHNLNKVLKSALNPKQATLHGRFHSYAVGDKVMQI
RNNYNKEVFNGDIGYISMINFENKRVVVNMEGKYVVYSFSELDALVLAYATSVHKYQGSE
SPCIILPIHTSHFMMLYRNLLYTAITRGKQLVVLVGTKKAIAIATRNDKVQHRCTGLGQA
LEQLTQPNIKLAHFHE
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaatttccggaaaattagaaggcgtactttttgaagatcacgattcaaaggaa
accgttgcacgtataagaataccttataagggtacgctcgttgtcataaaaggccaattc
ccagatttttttctacagattggcatgcagctacatttatatggaaaatggtccgaaaac
cctaatctaggacaatatttccaagtatatagctgtgattctcaagaaatgcgagataat
cgaggtataatcaattaccttacctctaagcttatcaagggtatcggaccaaaaattacc
gaaaaaatcctcgaaaaattccaaaatgacactgcgtatatcctcgataatcatcccgaa
agattaatagaagttcctggaatcagcaaaaaccgctgcgacaatctctgcgcacaactt
cgtgaacaaaaagatcttagaacaacattgctattcctacagcaatacgatattgctatc
cactacggtgtaaaaatttttaaaaagtataaagagcacgctatagagaaaatctgtgaa
gatccttttcttttagctagagaaatggagggaatcggatttaaaaccgcggatcttatt
gcaacacgcctaggcgtgcctttaaattcgcaaagtcgattatttgcaggaatacaacat
gcccttgaagaacttcaagaagatggacatacttgctatcctctacaaggtctcgctcaa
gctgtagaaaaactccttaatcaagatattccagaaaaactcatacaaattgaagagatt
atttctcaagtgcatcttatgcaagagaaaaatatcttacatattcaagagttggaaacc
accccacacgtatggacaaagcatatttaccttgcggaaaagactgtggtttctgatcta
aaaaggatcttattttcctcaagaaaaatccgctctatagatggaaataaagccattcaa
tgggttgagaataacctaaaccttcatctagagcagaatcaaaaagaggctgttcgcgcg
tgtttctcagagaaaatccatatcattaccggaggaccaggaactggaaaaagtaccatt
actaaatcaatactaaagatattcgagcaggttacctataaaatcattttagctgctccc
acagggaaagcagctaaacgcatgacagaaattactggcaagcactcggtaactattcat
gcgctactacagtacgattttaaaacccgatcttttcgaaaaaactatgaaaacccaata
gattgcgatcttatcatagttgatgaatcgggaatgatggatacatatctgttgtatcat
tttctaaaagcacttcccgatcatgctatcgttatattcattggagatgttcatcagtta
cctagtatcggcccaggaaacatcctcaaagatattatcaattctagaaagattactgta
acgaagctaaataagatttttcgtcaggtacatgattctaatattattaccaatgctcat
aaagtcaacgcgggcgagtttcctatactccactctgaatcaggccgtaaggatttcctg
tttttccaaaaagaagatcctcaagaagccgtggatcatattgttcatctagtcacacaa
tttatcccgaagaaataccacatctatcctaaagatattcaaattctcgcccccatgaaa
aaaggcattttgggaattcataatctcaataaggttttaaaatcagctttaaacccaaag
caagcaactcttcacggtagatttcattcctatgccgtaggagataaagttatgcaaatc
cgcaataattataataaagaggtattcaatggagacatcggctacatctctatgattaac
tttgaaaacaaacgtgtggtagtcaatatggaaggaaagtacgtcgtgtactcattctcg
gagcttgatgctctcgttttagcttatgctacctcagtacataaataccaaggaagcgaa
agcccctgtattatccttcccatacacacgtcccacttcatgatgctctataggaatctt
ctctataccgccattacgagaggaaagcagcttgttgtcttagtaggaacaaaaaaagct
attgctatagctacaagaaacgataaggtacaacaccgctgcacaggacttgggcaagct
cttgagcaacttacccaacccaatatcaagcttgcccattttcacgaataa

DBGET integrated database retrieval system