KEGG   Chlamydophila felis: CF0395Help
Entry
CF0395            CDS       T00332                                 

Gene name
pfkA2
Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cfe  Chlamydophila felis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:cfe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CF0395 (pfkA2)
   01230 Biosynthesis of amino acids
    CF0395 (pfkA2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CF0395 (pfkA2)
   00030 Pentose phosphate pathway
    CF0395 (pfkA2)
   00051 Fructose and mannose metabolism
    CF0395 (pfkA2)
   00052 Galactose metabolism
    CF0395 (pfkA2)
  Energy metabolism
   00680 Methane metabolism
    CF0395 (pfkA2)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CF0395 (pfkA2)
Enzymes [BR:cfe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CF0395 (pfkA2)
Protein phosphatases and associated proteins [BR:cfe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CF0395 (pfkA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(469156..470811)
Genome map
AA seq 551 aa AA seqDB search
MHPNFSDLRGVVIPDRPTLPRELQKFPSLIPINDQRFSPKFDADIAKLFPKTYDSPYLKF
TSGSPKSSQPLKVGVMLSGGPAPGGHNVIWGLLHSLKKVHPDSSLIGFLNNGQGILNNNT
IEITEEFMECFRNSGGFNCIGTGRTNIITEENKAACLKTVQALDLDGLVIIGGDGSNTAT
AILAEYFAQHHPKTCVLGVPKTIDGDLQHLFLDLTFGFDSATKFYSSIISNISRDTLSCK
AHYHFIKLMGRSASHIALECTLQTHPNITLIGEEIAEKNVPLKTIIHKICSIISDRASMG
KYYGIILIPEGMIEFIPEINNLVKEIERIPESSDKFSLLSQESQKLLKSFPEAIANQLLY
DRDAHGNVYVSKISIDKLLIHLVDNHLKKHFKNVPFNAVSHFLGYEGRSCLPTKFDNTYS
YALGYGAGVLTYNRCNGYLTVIESLINIVDKWRLRAIPIVKMFTAKKKSDGTIKPLIKKS
LVDISSPAFLKFKLYRKIWALEDSYRYLGPLQIDTPPDSHSDHFPPLTLLLNHNEWQKRC
SICMEIPDCDY
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgcacccaaattttagtgatctccgtggtgtggttattcctgacaggcctaccctgcct
agagaactacaaaaatttccttctttaattcctattaatgaccaacgtttttctcctaag
tttgatgccgatatcgctaagctttttcctaaaacctacgatagtccctatctaaaattc
acttcgggatctcctaagtcttcgcaaccattaaaagtcggcgttatgctatccggaggt
cctgctcctggagggcataatgtgatttggggacttctacatagcttaaaaaaggtccat
cccgatagttctttaataggttttctcaataatggtcagggcattctcaataacaatacc
atagaaattaccgaagaattcatggaatgttttagaaattctggaggattcaactgcata
ggaacaggaagaacaaatatcatcaccgaagaaaataaagcagcatgtttaaaaacggta
caagctttggatcttgatggtttggtaattattggtggtgatggttcgaatacagcaact
gctatccttgcagaatactttgctcaacatcatcctaaaacatgtgttcttggtgttccc
aaaactattgatggggatctccaacacctatttttagaccttactttcggatttgattct
gctacaaaattttactcatcaatcattagcaatatttcaagagatactctttcttgcaaa
gctcattaccattttataaaacttatgggacgttctgcttctcatattgctttagagtgc
accctacaaacacatcccaatattacccttataggcgaagaaatcgcagaaaagaacgtc
cctttgaaaactataatccacaagatatgctcgataatttctgatagagcatctatggga
aaatactacgggataattctgattcctgagggcatgattgaattcatcccagagattaat
aatcttgtaaaagaaattgaaagaatccccgaaagttcggataaattctctttgctatct
caagaatctcagaaattgctaaagagcttcccagaagctattgctaatcagctgctctat
gatcgagatgctcacggaaatgtttatgtctctaaaattagcatagataagttgctcata
catcttgttgacaaccacctaaagaagcactttaaaaacgttccctttaacgcggtttct
catttcttaggttatgagggaagatcctgtttaccgacgaaatttgataatacctacagc
tatgctctaggatacggtgctggagtacttacgtataaccgttgtaacggctatctaaca
gtgatcgaatctcttatcaatatagtagataaatggcggttacgtgccatacctatcgta
aaaatgtttactgcaaagaaaaaatcagacggaacaataaaacctctaatcaagaagagt
ttagtcgatatcagtagtcctgcttttcttaagtttaaattatacagaaaaatctgggct
cttgaagattcttaccgctatctaggaccgttacaaattgatactccaccggactctcat
tccgatcatttccctccactaactcttcttctcaatcataacgaatggcaaaaaagatgc
tctatctgtatggaaatccctgactgcgattattaa

DBGET integrated database retrieval system