KEGG   Chlamydophila felis: CF0435Help
Entry
CF0435            CDS       T00332                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cfe  Chlamydophila felis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cfe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CF0435 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CF0435 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CF0435 (trpA)
Enzymes [BR:cfe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CF0435 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(510526..511299)
Genome map
AA seq 257 aa AA seqDB search
MNRIETAFKNTKPFIGYLTGGDGGFDYSVACAHALLRGGVDILEIGFPFSDPVADGPIIQ
KAHTRALKEKTDSTTILEIAKALRQTSDIPLVLFSYYNPLLQKGPQYLHQLKAAGFDAVL
TVDLPIPRNANESESFFQALMEAKLFPILLVTPSTQEERLLQISKLAKGFLYYVSHKGTT
GIRSKLSDDFSTQIARLRRYFQIPIVAGFGIANRASAIAALEHADGFVVGSAFVEKLEKK
ISPEELTTFAQSIDPRQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaattgaaacagcatttaaaaatacaaaacccttcattggatatttgacagga
ggggatggcggatttgactacagcgttgcatgtgctcacgctttacttcggggaggtgtt
gacatcttagaaataggcttccctttttcagatcctgttgcagacggtcctataatccaa
aaagctcacacaagagcattaaaagaaaagaccgactctactaccattttagaaatcgca
aaagctttgcgtcaaacttctgacattcctttggtgttatttagctattataatccgctt
ttgcaaaaaggcccccaatatttgcatcagttaaaagccgcaggatttgatgctgtttta
actgtagacctacccattcctaggaatgcaaatgaatcagaatccttctttcaagcttta
atggaagctaagttgttccccatattattagtcacaccttctacccaggaagaacgatta
ttacaaatcagtaagttagcaaaaggttttctctattatgtttctcataaaggaactaca
ggaataagaagcaaactctctgatgatttttctacacaaatagcgagattacgtcgatat
tttcaaattccgattgttgctggatttggaatagctaaccgagctagtgctatagcagct
ttagaacatgctgatggctttgttgtaggttccgcttttgtggagaaattagaaaagaaa
atatctcctgaagaacttacaacatttgctcaatccatagatccccgccagtaa

DBGET integrated database retrieval system