KEGG   Chlamydia felis Fe/C-56: CF0435Help
Entry
CF0435            CDS       T00332                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cfe  Chlamydia felis Fe/C-56
Pathway
cfe00260  Glycine, serine and threonine metabolism
cfe00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cfe01100  Metabolic pathways
cfe01110  Biosynthesis of secondary metabolites
cfe01130  Biosynthesis of antibiotics
cfe01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cfe00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CF0435 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CF0435 (trpA)
Enzymes [BR:cfe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CF0435 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB Peripla_BP_6
Motif
Other DBs
NCBI-ProteinID: BAE81207
UniProt: Q254T1
Position
complement(510526..511299)
Genome map
AA seq 257 aa AA seqDB search
MNRIETAFKNTKPFIGYLTGGDGGFDYSVACAHALLRGGVDILEIGFPFSDPVADGPIIQ
KAHTRALKEKTDSTTILEIAKALRQTSDIPLVLFSYYNPLLQKGPQYLHQLKAAGFDAVL
TVDLPIPRNANESESFFQALMEAKLFPILLVTPSTQEERLLQISKLAKGFLYYVSHKGTT
GIRSKLSDDFSTQIARLRRYFQIPIVAGFGIANRASAIAALEHADGFVVGSAFVEKLEKK
ISPEELTTFAQSIDPRQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaattgaaacagcatttaaaaatacaaaacccttcattggatatttgacagga
ggggatggcggatttgactacagcgttgcatgtgctcacgctttacttcggggaggtgtt
gacatcttagaaataggcttccctttttcagatcctgttgcagacggtcctataatccaa
aaagctcacacaagagcattaaaagaaaagaccgactctactaccattttagaaatcgca
aaagctttgcgtcaaacttctgacattcctttggtgttatttagctattataatccgctt
ttgcaaaaaggcccccaatatttgcatcagttaaaagccgcaggatttgatgctgtttta
actgtagacctacccattcctaggaatgcaaatgaatcagaatccttctttcaagcttta
atggaagctaagttgttccccatattattagtcacaccttctacccaggaagaacgatta
ttacaaatcagtaagttagcaaaaggttttctctattatgtttctcataaaggaactaca
ggaataagaagcaaactctctgatgatttttctacacaaatagcgagattacgtcgatat
tttcaaattccgattgttgctggatttggaatagctaaccgagctagtgctatagcagct
ttagaacatgctgatggctttgttgtaggttccgcttttgtggagaaattagaaaagaaa
atatctcctgaagaacttacaacatttgctcaatccatagatccccgccagtaa

DBGET integrated database retrieval system