KEGG   Chlamydophila felis: CF0551Help
Entry
CF0551            CDS       T00332                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cfe  Chlamydophila felis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CF0551 (malQ)
Enzymes [BR:cfe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CF0551 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
648389..649981
Genome map
AA seq 530 aa AA seqDB search
MTPFSKAIRYIQDSPAKHSWKILGTMPKHGICTPLFSLHTQNSCGIGEFLDLIPLILWCR
KHKFQILQILPINDSGEDCSPYNSISSVALNPLYLSLSSLPHARSIPYADAKIRTMQQLS
KLPYVHYPQVKAAKWEFLRDYYQYVIKIGVLKEEDFQIFCEKEKYWLHPYSVFRSIKHHL
KGAPINNWPKAYTDIKNFTEFEKQFQDECNFFSYLQFLCFQQMSQVKAYADDNQIFLKGD
LPILISKDSCDVWYYRQFFASSGSAGAPPDIYNTEGQNWHLPIYNMRNLAQDNYSWWKAR
LRYAENFYSLYRLDHIVGFFRLWVWDSSGNGKFKPENPEEYISQGTNILTQILRSSRMLP
IGEDLGSVPNDVKRTLVKLGICGTRIPRWERNWEGDGSFIPLDQYSPLSVTSLSTHDSDT
LALWWRHAPKEAQKFAKFLGMFFTPLLSTEDQKHILKLSHKTSSIFHINLINDYLALCPD
LVSDNLKYERINMPGTMSKNNWVYRVKPSIEEMLSHDALNANIADILSSL
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgactccattttctaaagctatacgctatatccaagactctcctgctaagcatagctgg
aaaatactgggaaccatgccaaagcatggtatttgtactcccttattttccctacatact
caaaatagctgcggaatcggggaatttttagaccttattcctttaattttatggtgtaga
aaacacaaattccaaatcttacaaattcttcctatcaatgatagtggagaagattgcagc
ccctataatagcatatcttcagtagcccttaatcctctttacctttccttatcaagtctt
ccccacgcccggtctattccctatgctgatgccaagataagaactatgcaacagctatct
aagcttccttatgtacactatcctcaagtcaaagccgcaaaatgggaattcctccgagat
tattatcagtatgtaataaaaataggagtcttgaaggaagaagattttcagatcttttgc
gaaaaggaaaagtattggctacatccctattcagtatttcgttccataaagcatcaccta
aaaggagctccgataaataactggccaaaagcctatacagacattaaaaacttcacagaa
tttgagaaacaattccaagacgaatgtaactttttctcttatttacaattcctttgtttt
cagcaaatgtcacaagtgaaagcctacgctgatgacaatcagattttccttaaaggagat
ctccctattcttattagtaaagatagttgcgatgtttggtactacaggcagttctttgct
tcctcaggatccgcaggcgctcctcctgatatttacaatacagaggggcagaactggcat
cttcctatctacaacatgcgcaacttagcccaagataattatagctggtggaaagcgcgt
ttacggtatgcagaaaacttttactctctttatagacttgatcacattgtgggatttttt
cgcctctgggtgtgggactcttctggaaatggaaaatttaaaccggaaaatccagaggaa
tacattagccaagggacaaacattcttacgcagattctacgttcctctcgtatgcttccc
ataggagaagatttgggaagtgtgcctaatgatgtaaaacgtactttagtaaaactagga
atatgtggaacacgcattcctcgttgggagcgcaactgggaaggagatggaagcttcatc
cccctagaccaatactcccctctctcagtaacatcattatccactcatgattcggataca
cttgctctttggtggcgacacgctcccaaagaagctcaaaaatttgctaagtttttagga
atgtttttcactcctcttttatccacagaggatcaaaaacatattctcaagttatctcat
aaaacttcatcgatctttcatattaacttaattaacgactaccttgctctctgtcctgat
ttagtatccgataatctaaaatacgaacgcataaatatgcctggcacaatgtcaaaaaat
aattgggtgtacagagtaaagccttctattgaagaaatgctttctcacgacgctttaaat
gcaaatatagctgatattttatctagtctttaa

DBGET integrated database retrieval system