KEGG   Chlamydophila felis: CF0740Help
Entry
CF0740            CDS       T00332                                 

Gene name
glgB
Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cfe  Chlamydophila felis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cfe00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(878397..880562)
Genome map
AA seq 721 aa AA seqDB search
MVERILNSEDISLLISGRQSNPHKLLGIISENSSQDRIILFRPGAHSVAVELQGNIEHAT
HHHSGIFSLTTPKGTLLNDYRIYHQNGLLAHDPYAFSPLWGEIDSFLFHQGTHYKIYERM
GAIPCDVRGISGVLFVVWAPHAQRVSVIGDFNFWNGLVNPLRKVSDSGVWELFIPGLDEG
TLYKWEIVSASGEILIKTDPYGKGFDVPPLATSRVINSDRYVWHDAEWMEKRSCTQDQPL
SIYEVHVGSWQWQDGRPIGYRGLAERLAQYCKEMSYTHIELLPITEHPLNESWGYQVTGY
YAPTWRYGSPEDFQFFVDHLHSEGIGVILDWVPGHFPTDTFALAHFDGEALYESVDHKEP
LHPHWHTYTFDYRCNEVVNFLLGSALFWLDKMHIDGLRVDAVTSMLYLDYGRKEGEWSPN
IHGGKENLDAIEFLKHFNFIVHKEFPGVMTFAEESTDFPKVTEPINSGGLGFDYKWNLGW
MHDTFRYLKVDPIFRAYHHNDLTFSIWYAFKENYLLPLSHDEVVHGKGSLLQKVPGDTWS
KFAHMRLLLSYQICQPGKKLVFMGGEFAQGREWSPDRSLDWHLLDNPYHATLHKCVAKMN
SLYRDLPYFWQGDGKQESFRWIDFKDTENNVISYYRLSGNDSNQALLCIHHFSSGYIPSY
VLHCQGIKMCQLLFNSDDIGFGGSGKGNRPPILCIDHGFSWGIDIELPPLATLIFLVRFS
N
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atggttgagaggattttaaactctgaggacatctccttgttgatttcgggaaggcagagt
aatcctcataagttgttggggattatttccgagaattcctctcaagatagaattattctt
tttcgacctggagcacattctgtagctgtagagcttcaaggaaatatagagcacgctacg
catcaccattccggaatattttctctaacaactcccaagggtacccttcttaatgactac
cggatctatcatcaaaatggtttattagctcatgacccttacgcattttctcctttatgg
ggagagatagactcctttttatttcaccaaggaacacattacaaaatttacgagcgcatg
ggagcaatcccttgtgatgttcggggaatttctggcgtgctctttgttgtatgggctcct
catgcacaacgtgtatctgttattggagattttaatttttggaatggtctcgttaaccct
ttgcgcaaggtttcagattcaggggtttgggagttatttattcctggtcttgatgaggga
acactatataaatgggaaattgttagtgcttccggagaaattcttatcaaaacagatcct
tatgggaaaggttttgatgttcctccgctcgcaacatctcgagttattaacagcgatcgc
tatgtatggcacgatgccgaatggatggaaaagcgcagctgtacacaagatcagccttta
tctatttatgaggtacatgttgggtcttggcaatggcaagatggtagacctatagggtat
cgggggctggcagagagactcgctcagtattgcaaggaaatgagctatacgcatattgag
ctcttgcctattacagaacaccctttaaatgaatcttggggatatcaggtcacaggatat
tacgcgcctacatggcggtatggatctcccgaagactttcaattttttgtcgatcacctt
cacagtgagggtattggggtaattttagattgggtgccggggcatttcccaacggatact
tttgctcttgcccattttgacggggaggctctgtatgagtctgtagatcataaagaaccc
ctccatccccactggcatacttatacttttgattatcgctgcaatgaggttgtgaatttc
cttttaggaagtgctctcttttggttggataaaatgcatatagacggtttgcgtgtggat
gctgtgacctctatgctgtatttagactatggtagaaaagagggagaatggtcgccaaat
atccatggaggaaaagaaaatctcgatgctattgagtttctcaaacactttaactttata
gtgcacaaggaattccccggagtaatgacatttgctgaagagtctacagatttcccgaaa
gttacagaacctataaattccggaggcttaggttttgattataaatggaacctaggatgg
atgcacgatacctttcgttatcttaaggtagatcccatatttcgtgcttaccatcataac
gatctgacatttagcatttggtatgcttttaaagaaaactatctcctacctctttctcat
gacgaggttgtccatggtaagggaagcctattacaaaaagttcccggagatacctggtcg
aaatttgcccatatgcgtttgttgctaagctatcagatatgccagccaggcaaaaaactt
gtattcatgggaggagaatttgcccaggggagggagtggtcgccagatagatccctagat
tggcatttattagacaatccttatcacgctactttacacaaatgtgtggcaaaaatgaac
tccttgtatcgtgaccttccctatttttggcaaggagacggtaagcaagagtcttttcgt
tggatagattttaaagatacggaaaataacgtcatttcttattacagactttccggaaat
gactctaatcaagctctactgtgtattcaccattttagctcgggatacattccctcttat
gttctacattgccaaggcattaagatgtgtcaattgcttttcaatagcgatgacataggg
tttgggggatccggaaaaggaaaccgtccgcctatattgtgcatagatcatggcttctcc
tggggaatcgatatagaactccccccactggctactctgatttttcttgttcgcttttca
aattaa

DBGET integrated database retrieval system