KEGG   Chlamydophila felis: CF0789Help
Entry
CF0789            CDS       T00332                                 

Gene name
sucB2
Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cfe  Chlamydophila felis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cfe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CF0789 (sucB2)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CF0789 (sucB2)
  Amino acid metabolism
   00310 Lysine degradation
    CF0789 (sucB2)
Enzymes [BR:cfe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CF0789 (sucB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(931251..932420)
Genome map
AA seq 389 aa AA seqDB search
MFEFRFPKIGETASGGFVVRWLKQVDEYVAKDEPIIEVSTDKIATELASPKAGKLMRCLV
NEGDEVASGEVLAIIDTGSGAQEEVVAQESSSESSCSHDSGNHSTWFSPAVLSLAHREGV
SIQQLQQISGTGSEGRVTRKDLENYISELRQPACPNISNANENRIPMSPLRRAIASSLSK
SSDEVPHASLIVDIDVTDLMNLISEEKDRFFATHGVKLTITSFIIQCLAKALEQFPLLNG
SLDGDTIVVKKSINVGVAVNLNKEGVVVPVIRNCQDRGLVSIAKSLADLSVRARANKLDP
SETQDGSVTVTNFGMTGALIGMPIIRYPEVAILGIGTIQKRVIVRDDDSLVIRKMVYVTL
TFDHRVLDGIYGSEFLTSLKNRLESVTMS
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaatttcgatttccgaaaataggagagacagcttcaggaggatttgtagttcgt
tggctcaagcaggtagatgagtatgttgcaaaagacgaaccaataattgaagtgtctacg
gataaaattgctaccgagttagcatctcctaaagctgggaaattaatgcgttgtcttgta
aatgaaggtgatgaggttgcctcaggagaggttttagccataattgataccggatcagga
gctcaggaagaggtggttgcacaggaatcctcttccgaatcttcttgttctcacgactct
ggaaatcattcaacgtggttttctccagcggttcttagcttggcacatcgagagggtgtc
agtattcagcagctacaacaaatttctggaacaggaagtgaagggcgtgtaacccgtaaa
gacttagaaaattacatttctgaattacgtcagcccgcgtgtccaaatatttcgaatgct
aatgaaaatcgcattcctatgtctccactgcgtagagcgatagcctcttccttgtctaaa
tcttcagatgaggttcctcacgcttctcttattgtggatattgatgtcacagatttaatg
aatttaatttccgaagagaaggatagattttttgcaacacacggtgtgaaactgacaata
acgagtttcattatccaatgtttggcgaaagccttggaacagttcccgttattaaatgga
tctttagacggggatactatcgttgtgaagaaatccatcaatgtgggggttgctgttaat
ttgaataaagagggcgttgttgttcctgttattcgtaattgtcaggatcgcggtttggtc
agcattgcaaaaagtcttgcagatttatctgtaagagcgagagcaaataagctggacccc
tcagaaactcaagatggtagtgtcacagttaccaatttcggtatgactggagctttaata
ggcatgccaataattcgttatcctgaagtggctattttaggaataggaacaatacaaaaa
cgtgttattgttcgtgatgacgactctttggttatccgaaaaatggtctacgtcacccta
acgtttgaccatagagttcttgacggcatttacggtagtgaatttttaacctcattgaaa
aatcgattagagtctgttacgatgagctaa

DBGET integrated database retrieval system