KEGG   Chlamydophila felis: CF0789Help
Entry
CF0789            CDS       T00332                                 

Gene name
sucB2
Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cfe  Chlamydophila felis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cfe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CF0789 (sucB2)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CF0789 (sucB2)
  Amino acid metabolism
   00310 Lysine degradation
    CF0789 (sucB2)
Enzymes [BR:cfe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CF0789 (sucB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(931251..932420)
Genome map
AA seq 389 aa AA seqDB search
MFEFRFPKIGETASGGFVVRWLKQVDEYVAKDEPIIEVSTDKIATELASPKAGKLMRCLV
NEGDEVASGEVLAIIDTGSGAQEEVVAQESSSESSCSHDSGNHSTWFSPAVLSLAHREGV
SIQQLQQISGTGSEGRVTRKDLENYISELRQPACPNISNANENRIPMSPLRRAIASSLSK
SSDEVPHASLIVDIDVTDLMNLISEEKDRFFATHGVKLTITSFIIQCLAKALEQFPLLNG
SLDGDTIVVKKSINVGVAVNLNKEGVVVPVIRNCQDRGLVSIAKSLADLSVRARANKLDP
SETQDGSVTVTNFGMTGALIGMPIIRYPEVAILGIGTIQKRVIVRDDDSLVIRKMVYVTL
TFDHRVLDGIYGSEFLTSLKNRLESVTMS
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaatttcgatttccgaaaataggagagacagcttcaggaggatttgtagttcgt
tggctcaagcaggtagatgagtatgttgcaaaagacgaaccaataattgaagtgtctacg
gataaaattgctaccgagttagcatctcctaaagctgggaaattaatgcgttgtcttgta
aatgaaggtgatgaggttgcctcaggagaggttttagccataattgataccggatcagga
gctcaggaagaggtggttgcacaggaatcctcttccgaatcttcttgttctcacgactct
ggaaatcattcaacgtggttttctccagcggttcttagcttggcacatcgagagggtgtc
agtattcagcagctacaacaaatttctggaacaggaagtgaagggcgtgtaacccgtaaa
gacttagaaaattacatttctgaattacgtcagcccgcgtgtccaaatatttcgaatgct
aatgaaaatcgcattcctatgtctccactgcgtagagcgatagcctcttccttgtctaaa
tcttcagatgaggttcctcacgcttctcttattgtggatattgatgtcacagatttaatg
aatttaatttccgaagagaaggatagattttttgcaacacacggtgtgaaactgacaata
acgagtttcattatccaatgtttggcgaaagccttggaacagttcccgttattaaatgga
tctttagacggggatactatcgttgtgaagaaatccatcaatgtgggggttgctgttaat
ttgaataaagagggcgttgttgttcctgttattcgtaattgtcaggatcgcggtttggtc
agcattgcaaaaagtcttgcagatttatctgtaagagcgagagcaaataagctggacccc
tcagaaactcaagatggtagtgtcacagttaccaatttcggtatgactggagctttaata
ggcatgccaataattcgttatcctgaagtggctattttaggaataggaacaatacaaaaa
cgtgttattgttcgtgatgacgactctttggttatccgaaaaatggtctacgtcacccta
acgtttgaccatagagttcttgacggcatttacggtagtgaatttttaacctcattgaaa
aatcgattagagtctgttacgatgagctaa

DBGET integrated database retrieval system