KEGG   Chlamydophila felis: CF0886Help
Entry
CF0886            CDS       T00332                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cfe  Chlamydophila felis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cfe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CF0886 (ruvA)
Enzymes [BR:cfe01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     CF0886 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1041414..1042037)
Genome map
AA seq 207 aa AA seqDB search
MYDYIRGILTYMSSGTMVIECQGLGFSICASDRWLMELAGLLHREVIVYTYTVVRETEHV
LYGFRSRGERECFRMLISFSGVGPKTGLAILNTFALSKLCSIARAEDVKALASVPGIGKK
TAEKLMVDLKQKLPELLPLDSQTLTSWKPAKPSCMEDGIQALAALGYPKSSAERMIAEAI
TELPDNASLAEILPIALKKNLQGLNKS
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtacgactatattcgtggaattcttacttacatgagttcaggaacgatggtaatcgaa
tgccaaggattaggatttagtatttgtgcttccgatagatggcttatggagttagcaggg
ctgttacatcgcgaggttatagtttatacatatacggttgtgcgagagactgagcatgtt
ctttatggatttcgttctcgaggagaacgtgagtgtttccgcatgttaatatcgttttct
ggagtaggccctaagacagggctagcaattttaaatacatttgctcttagcaaattatgt
tctatagcgcgtgcagaggatgtaaaagccctagcatcagttcctggtatagggaagaaa
accgcagaaaagcttatggtagatctgaagcagaaacttccagaattacttcctttagat
tctcaaacactgacttcttggaaacctgcaaagccttcgtgtatggaagatggcatacaa
gctttagctgcgttagggtatccgaaatcttcagctgaaaggatgatagctgaagctata
acggaacttcctgataatgcttccctagcagagattcttcctattgctttaaaaaagaac
ttacaaggattgaacaagagctag

DBGET integrated database retrieval system