KEGG   Campylobacter fetus subsp. fetus 82-40: CFF8240_0102Help
Entry
CFF8240_0102      CDS       T00430                                 

Definition
(GenBank) phosphomannomutase/phosphoglucomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
cff  Campylobacter fetus subsp. fetus 82-40
Pathway
cff00010  Glycolysis / Gluconeogenesis
cff00030  Pentose phosphate pathway
cff00051  Fructose and mannose metabolism
cff00052  Galactose metabolism
cff00230  Purine metabolism
cff00500  Starch and sucrose metabolism
cff00520  Amino sugar and nucleotide sugar metabolism
cff01100  Metabolic pathways
cff01110  Biosynthesis of secondary metabolites
cff01120  Microbial metabolism in diverse environments
cff01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cff00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CFF8240_0102
   00030 Pentose phosphate pathway
    CFF8240_0102
   00051 Fructose and mannose metabolism
    CFF8240_0102
   00052 Galactose metabolism
    CFF8240_0102
   00500 Starch and sucrose metabolism
    CFF8240_0102
   00520 Amino sugar and nucleotide sugar metabolism
    CFF8240_0102
  Nucleotide metabolism
   00230 Purine metabolism
    CFF8240_0102
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CFF8240_0102
Enzymes [BR:cff01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     CFF8240_0102
    5.4.2.8  phosphomannomutase
     CFF8240_0102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV SatD
Motif
Other DBs
NCBI-ProteinID: ABK82774
UniProt: A0RM79
Position
83046..84413
Genome map
AA seq 455 aa AA seqDB search
MFDTIFREYDIRGIYEKDLNETSVKAIGYCLGVEMAKRDVKTISVGYDARLSADTLFKYL
ISGLNEAKMRVFDIGMLPTPVGYFSVFTDVFDANVMITGSHNPKEYNGFKITTHKDSFFG
ADLQKLKDSVNELISSKKQIKDNFEAQKYDILSKYVEFYKNEFSHLTGLKTKIICDCANG
TAGITLEPIIQALSLNATIFYKEPNGNFPNHHPDPSEEKNLKDLKNALSGEYEIGFGFDG
DADRIAVLTKKRSIKGDELAYLYAKNMKNPRVLGEVKCSQNMYDEIDKIGKSFMGKTGHS
NIKKAMKELNIDMAAEVSGHIFFKERFFGFDDAVYAMIRVLELIAKGFNLDDELDSLPKL
YSSDEIKIDTTEEMKFKIIDELKKELHNTKNGLPKIVDVIDIDGVRIKFENGWGLVRASN
TTPVLVARFEAGSLETKELLEQKVLSLVQKLKAKI
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgtttgatacgatttttagagagtatgatatcagaggtatttatgaaaaagatctaaac
gaaaccagcgttaaagccattggttattgtttaggtgtagagatggctaaaagagatgtt
aaaacgataagcgttggatatgatgctaggcttagcgccgatactctttttaaatattta
attagtggcttaaatgaagctaaaatgagagtatttgatataggtatgctgcctactcct
gttggatattttagtgtttttacagatgtttttgatgcaaacgtgatgattactggaagc
cataatccaaaagagtataatggatttaaaataacaactcataaagatagtttttttggc
gcagatcttcagaaattaaaagatagcgtaaatgaacttatttcttctaaaaaacagata
aaagataattttgaagcgcaaaaatacgatatattaagcaaatacgtagagttttataaa
aatgagttttcgcatttgaccggactgaaaacaaagattatttgcgattgcgcaaatggc
actgccggcattactttagagccgataatacaagctttgagtttaaacgctactatcttt
tataaagagccaaacggaaactttccaaatcaccatccagatcctagcgaagagaaaaat
ttaaaagatttaaaaaacgctttaagtggtgaatacgagattggttttgggtttgacgga
gacgcagatagaatagctgttttaactaaaaaaagaagcataaagggtgacgagttagcc
tatttgtatgcaaaaaatatgaaaaaccctagggttttaggcgaagttaaatgttcgcaa
aatatgtatgatgaaatagacaaaatcggtaaatcttttatgggtaaaacaggtcatagt
aatataaaaaaggctatgaaagaactaaatatcgatatggctgctgaggttagcggacat
atattttttaaagagagattttttggttttgatgacgcggtttatgctatgataagagtt
ttggagcttattgcaaaaggatttaaccttgatgatgagcttgatagccttccaaagtta
tactcgagcgatgagataaaaatagataccaccgaagagatgaaatttaaaattatagat
gaattaaaaaaagaacttcacaataccaaaaacggacttcctaagatagtcgatgttatc
gatatagacggtgttaggattaaatttgaaaatggctggggtcttgtaagagcttcaaat
acgacaccggttttagtagctagatttgaagccggttcgttagaaactaaagagctttta
gagcaaaaagtactatctttagtacaaaagttaaaggcaaaaatatga

DBGET integrated database retrieval system