KEGG   Campylobacter fetus subsp. fetus 82-40: CFF8240_0197Help
Entry
CFF8240_0197      CDS       T00430                                 

Definition
phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
cff  Campylobacter fetus subsp. fetus 82-40
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cff00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CFF8240_0197
   00565 Ether lipid metabolism
    CFF8240_0197
   00590 Arachidonic acid metabolism
    CFF8240_0197
   00591 Linoleic acid metabolism
    CFF8240_0197
   00592 alpha-Linolenic acid metabolism
    CFF8240_0197
Enzymes [BR:cff01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     CFF8240_0197
    3.1.1.32  phospholipase A1
     CFF8240_0197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
180643..181665
Genome map
AA seq 340 aa AA seqDB search
MRKLLTILASFLSLNANNANELYKKAIEFESKGDSKNALIYYKMAAQKALENEQTRTDHI
SNLDKNQNLQKDSTHSIWQQTTQTTNLKYSQNNRIIKAENNKENNYNIFHLEPYKVNYLL
PITYSSISNSDRKHTETKFQLSLKKAMFDNLFGLDETFYLGYTQISWWQIAKESSPFRES
NYQPEIFVDFPFKFDNFETLKSAQIGILHDSNGKSGKDSRSWNRVYLRSVFEYGNFSLAP
RVWYRIKDNKDDNPDITNYKGNADIEISYNLNNMRFIATIANNLHFDKTNKGFFQFDFLF
PIFNSGFYGYLQYFNGYAQSLIDYDKHESRVGAGFVFFIR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaattgctaactattttggctagctttttaagtttgaatgcaaacaatgcaaat
gaactatataaaaaagcaattgaatttgagagtaaaggagatagtaaaaatgctcttatt
tactataaaatggctgctcaaaaagctttagaaaatgagcaaactagaaccgaccatatt
tcaaatttagataaaaatcaaaatttacaaaaagatagtacgcatagcatttggcagcaa
actactcagacgacaaacttaaaatatagtcaaaataaccgtataattaaagctgaaaat
aataaagaaaacaattataatattttccatttagaaccttataaggtaaattatcttctt
cctattacgtattctagtatatcaaattcagatagaaaacataccgaaacaaagttccag
cttagtctcaaaaaggcgatgtttgataatttatttgggcttgatgagactttttatctt
ggatatactcagatatcttggtggcagatagcaaaagagtcttctccgtttagagagagt
aattatcagccggagatctttgtagattttccttttaaatttgataattttgagactttg
aaatctgcccaaataggcatattacacgattcaaacggtaaaagcggtaaagattctaga
tcttggaatagagtctatttaagatcggtttttgagtacggaaattttagtttagctcct
agagtttggtataggattaaagacaataaagacgataatccagatatcaccaattacaaa
ggcaatgcagatatagagatatcttataatttaaataatatgagatttatagctactata
gcaaataacttgcattttgataagacaaataaaggtttttttcagtttgactttttattt
cctatatttaatagtggattttatggatatttacagtattttaacggatatgcgcaaagt
ctcatagactatgataagcatgagagccgagttggcgccggatttgtattttttatcaga
tag

DBGET integrated database retrieval system