KEGG   Campylobacter fetus subsp. fetus 82-40: CFF8240_0197Help
Entry
CFF8240_0197      CDS       T00430                                 

Definition
phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
cff  Campylobacter fetus subsp. fetus 82-40
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:cff00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:cff00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:cff00591]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:cff00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
180643..181665
Genome map
AA seq 340 aa AA seqDB search
MRKLLTILASFLSLNANNANELYKKAIEFESKGDSKNALIYYKMAAQKALENEQTRTDHI
SNLDKNQNLQKDSTHSIWQQTTQTTNLKYSQNNRIIKAENNKENNYNIFHLEPYKVNYLL
PITYSSISNSDRKHTETKFQLSLKKAMFDNLFGLDETFYLGYTQISWWQIAKESSPFRES
NYQPEIFVDFPFKFDNFETLKSAQIGILHDSNGKSGKDSRSWNRVYLRSVFEYGNFSLAP
RVWYRIKDNKDDNPDITNYKGNADIEISYNLNNMRFIATIANNLHFDKTNKGFFQFDFLF
PIFNSGFYGYLQYFNGYAQSLIDYDKHESRVGAGFVFFIR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaattgctaactattttggctagctttttaagtttgaatgcaaacaatgcaaat
gaactatataaaaaagcaattgaatttgagagtaaaggagatagtaaaaatgctcttatt
tactataaaatggctgctcaaaaagctttagaaaatgagcaaactagaaccgaccatatt
tcaaatttagataaaaatcaaaatttacaaaaagatagtacgcatagcatttggcagcaa
actactcagacgacaaacttaaaatatagtcaaaataaccgtataattaaagctgaaaat
aataaagaaaacaattataatattttccatttagaaccttataaggtaaattatcttctt
cctattacgtattctagtatatcaaattcagatagaaaacataccgaaacaaagttccag
cttagtctcaaaaaggcgatgtttgataatttatttgggcttgatgagactttttatctt
ggatatactcagatatcttggtggcagatagcaaaagagtcttctccgtttagagagagt
aattatcagccggagatctttgtagattttccttttaaatttgataattttgagactttg
aaatctgcccaaataggcatattacacgattcaaacggtaaaagcggtaaagattctaga
tcttggaatagagtctatttaagatcggtttttgagtacggaaattttagtttagctcct
agagtttggtataggattaaagacaataaagacgataatccagatatcaccaattacaaa
ggcaatgcagatatagagatatcttataatttaaataatatgagatttatagctactata
gcaaataacttgcattttgataagacaaataaaggtttttttcagtttgactttttattt
cctatatttaatagtggattttatggatatttacagtattttaacggatatgcgcaaagt
ctcatagactatgataagcatgagagccgagttggcgccggatttgtattttttatcaga
tag

DBGET integrated database retrieval system