KEGG   Campylobacter fetus subsp. fetus 82-40: CFF8240_0210Help
Entry
CFF8240_0210      CDS       T00430                                 

Gene name
dxr
Definition
(RefSeq) 1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
  KO
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
cff  Campylobacter fetus subsp. fetus 82-40
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cff00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CFF8240_0210 (dxr)
Enzymes [BR:cff01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     CFF8240_0210 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
188752..189834
Genome map
AA seq 360 aa AA seqDB search
MILLGSSGSIGKNVAFLAMKYGIKLDALACKTDYKELNSQISKFNPKFVYIEDNKLKNLV
EHSRVFTSKDGIDKFLEACYDEFGSTVVINSLVGFSGLRPSLVSQKLGFKLALANKESLV
AGGKFLDTKSINPIDSEHFGLKFLLKNRPAVKKMIITASGGAFYDMHINELEFVTAKSAL
KHPNWSMGAKITIDSATMANKLFEVLEAYHLYGIKDIDAFIERTSCIHALISFMDGSTTA
HISRTDMKLAIAHAIGLEEKEILEPIDILSLKNISFNTINLKKYPIFTLKKDVLNNPDLG
VIINAANEEMVYKFLNNEISFLDINRAVFKSLDKFGSVKIDDEDTVFEIDKKVREFCKGF
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgatactattaggcagtagcggcagcataggaaaaaatgttgcttttttggctatgaag
tatggtatcaaactagatgctttagcttgtaaaacagattataaagaacttaatagccaa
atttctaaatttaatcctaaatttgtttatatagaagataataaattaaaaaatcttgtg
gagcatagtagagtttttactagcaaagatggcatagataaatttttagaagcttgttat
gatgagtttggttctaccgttgttatcaactcattagtgggttttagtgggttgagaccg
agtttagtttctcaaaaacttggatttaagctagctttggcaaataaagagagtttagta
gcaggcggtaaatttttagacacaaaaagtattaatcctatagatagtgagcattttggg
cttaaatttttgcttaaaaatagacctgctgtcaaaaaaatgattataactgcgagcggt
ggcgcattttatgatatgcacataaacgaacttgagtttgtaactgctaaaagcgctctg
aaacatccaaattggagcatgggagcaaaaataactatagatagtgcgactatggcaaac
aagctatttgaagtgcttgaagcttatcatttatacggtattaaagatatagatgctttt
atagagcgtacatcttgtattcatgctcttataagttttatggacggttctactactgct
catatatcaagaaccgatatgaaactagccattgctcatgcaataggtcttgaagagaaa
gaaatcttagaacctattgatattttaagcttaaaaaatattagtttcaatactataaat
ttaaaaaaataccctatatttactctaaaaaaagatgttttaaataatccggatttaggc
gttatcataaatgcggcaaatgaagagatggtatataaatttttaaataacgaaatttcg
tttttagatatcaatagagctgtttttaaatcgcttgataaatttggaagcgttaaaata
gacgatgaagatactgtttttgagatagataaaaaagtcagagagttttgtaaaggattt
taa

DBGET integrated database retrieval system